Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JS43

Protein Details
Accession W4JS43   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
130-150SNKNGGTERKKRSLLRRNKAKBasic
NLS Segment(s)
PositionSequence
137-150ERKKRSLLRRNKAK
Subcellular Location(s) mito 8extr 8, plas 6, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG hir:HETIRDRAFT_411809  -  
Amino Acid Sequences MEPYLYLALARLSPWPSFLHTVRRYSRIDLFSLVLTITFFLGAIAGIVLFVRRISEFVNATKASLQEKGWTVSNQGVSVRTSKRLDREDYIDATQRGIMKVVGASKFGHAASASTTSLDGEDRANADGSSNKNGGTERKKRSLLRRNKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.2
4 0.25
5 0.27
6 0.34
7 0.36
8 0.44
9 0.47
10 0.51
11 0.5
12 0.49
13 0.54
14 0.46
15 0.43
16 0.37
17 0.33
18 0.27
19 0.25
20 0.2
21 0.13
22 0.1
23 0.08
24 0.06
25 0.05
26 0.04
27 0.04
28 0.04
29 0.03
30 0.03
31 0.03
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.06
42 0.1
43 0.12
44 0.13
45 0.18
46 0.17
47 0.17
48 0.17
49 0.17
50 0.15
51 0.16
52 0.15
53 0.13
54 0.15
55 0.16
56 0.16
57 0.15
58 0.15
59 0.16
60 0.16
61 0.14
62 0.13
63 0.12
64 0.11
65 0.15
66 0.15
67 0.17
68 0.19
69 0.21
70 0.26
71 0.29
72 0.32
73 0.31
74 0.34
75 0.33
76 0.33
77 0.33
78 0.31
79 0.26
80 0.23
81 0.22
82 0.18
83 0.16
84 0.14
85 0.12
86 0.08
87 0.1
88 0.13
89 0.12
90 0.12
91 0.13
92 0.13
93 0.15
94 0.14
95 0.13
96 0.1
97 0.09
98 0.1
99 0.13
100 0.12
101 0.11
102 0.11
103 0.1
104 0.11
105 0.11
106 0.1
107 0.07
108 0.08
109 0.09
110 0.1
111 0.11
112 0.1
113 0.11
114 0.15
115 0.17
116 0.21
117 0.2
118 0.2
119 0.2
120 0.23
121 0.31
122 0.36
123 0.43
124 0.47
125 0.55
126 0.62
127 0.69
128 0.78
129 0.8
130 0.81