Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JS43

Protein Details
Accession W4JS43    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
130-150SNKNGGTERKKRSLLRRNKAKBasic
NLS Segment(s)
PositionSequence
137-150ERKKRSLLRRNKAK
Subcellular Location(s) mito 8extr 8, plas 6, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG hir:HETIRDRAFT_411809  -  
Amino Acid Sequences MEPYLYLALARLSPWPSFLHTVRRYSRIDLFSLVLTITFFLGAIAGIVLFVRRISEFVNATKASLQEKGWTVSNQGVSVRTSKRLDREDYIDATQRGIMKVVGASKFGHAASASTTSLDGEDRANADGSSNKNGGTERKKRSLLRRNKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.2
4 0.25
5 0.27
6 0.34
7 0.36
8 0.44
9 0.47
10 0.51
11 0.5
12 0.49
13 0.54
14 0.46
15 0.43
16 0.37
17 0.33
18 0.27
19 0.25
20 0.2
21 0.13
22 0.1
23 0.08
24 0.06
25 0.05
26 0.04
27 0.04
28 0.04
29 0.03
30 0.03
31 0.03
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.06
42 0.1
43 0.12
44 0.13
45 0.18
46 0.17
47 0.17
48 0.17
49 0.17
50 0.15
51 0.16
52 0.15
53 0.13
54 0.15
55 0.16
56 0.16
57 0.15
58 0.15
59 0.16
60 0.16
61 0.14
62 0.13
63 0.12
64 0.11
65 0.15
66 0.15
67 0.17
68 0.19
69 0.21
70 0.26
71 0.29
72 0.32
73 0.31
74 0.34
75 0.33
76 0.33
77 0.33
78 0.31
79 0.26
80 0.23
81 0.22
82 0.18
83 0.16
84 0.14
85 0.12
86 0.08
87 0.1
88 0.13
89 0.12
90 0.12
91 0.13
92 0.13
93 0.15
94 0.14
95 0.13
96 0.1
97 0.09
98 0.1
99 0.13
100 0.12
101 0.11
102 0.11
103 0.1
104 0.11
105 0.11
106 0.1
107 0.07
108 0.08
109 0.09
110 0.1
111 0.11
112 0.1
113 0.11
114 0.15
115 0.17
116 0.21
117 0.2
118 0.2
119 0.2
120 0.23
121 0.31
122 0.36
123 0.43
124 0.47
125 0.55
126 0.62
127 0.69
128 0.78
129 0.8
130 0.81