Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JZ64

Protein Details
Accession W4JZ64    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
103-129ASASGPRSRPHRARRRLRLRLWTARLPHydrophilic
NLS Segment(s)
PositionSequence
108-121PRSRPHRARRRLRL
Subcellular Location(s) mito 16, nucl 10.5, cyto_nucl 6
Family & Domain DBs
KEGG hir:HETIRDRAFT_108978  -  
Amino Acid Sequences MHAHMHTHARRPPPTPSVARAVHAHASASASMHAFCSPHHARARSPPPLLSLALHMRTLPPPTPDRPCVHRARSPPHTPTVAHTAYTHAASAAQTAHSPPPTASASGPRSRPHRARRRLRLRLWTARLPSSLLPAPHACTPPLLYTLFHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.52
4 0.52
5 0.49
6 0.48
7 0.43
8 0.41
9 0.36
10 0.32
11 0.28
12 0.2
13 0.2
14 0.17
15 0.16
16 0.13
17 0.1
18 0.1
19 0.1
20 0.1
21 0.09
22 0.08
23 0.16
24 0.18
25 0.24
26 0.3
27 0.31
28 0.33
29 0.42
30 0.5
31 0.49
32 0.48
33 0.42
34 0.39
35 0.39
36 0.38
37 0.28
38 0.24
39 0.21
40 0.21
41 0.2
42 0.17
43 0.16
44 0.17
45 0.19
46 0.16
47 0.16
48 0.18
49 0.22
50 0.27
51 0.31
52 0.32
53 0.35
54 0.4
55 0.43
56 0.44
57 0.46
58 0.46
59 0.49
60 0.53
61 0.54
62 0.5
63 0.46
64 0.43
65 0.38
66 0.35
67 0.35
68 0.28
69 0.23
70 0.21
71 0.19
72 0.19
73 0.18
74 0.16
75 0.09
76 0.09
77 0.08
78 0.08
79 0.07
80 0.06
81 0.06
82 0.07
83 0.1
84 0.1
85 0.11
86 0.1
87 0.14
88 0.14
89 0.15
90 0.15
91 0.2
92 0.25
93 0.29
94 0.33
95 0.33
96 0.37
97 0.44
98 0.53
99 0.56
100 0.62
101 0.67
102 0.75
103 0.82
104 0.88
105 0.9
106 0.89
107 0.89
108 0.87
109 0.87
110 0.83
111 0.79
112 0.72
113 0.65
114 0.58
115 0.5
116 0.42
117 0.37
118 0.34
119 0.27
120 0.27
121 0.26
122 0.28
123 0.3
124 0.31
125 0.26
126 0.24
127 0.26
128 0.24
129 0.25
130 0.23