Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JT98

Protein Details
Accession W4JT98   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MALMPKRPHKRKSKAAASVRLPPQHydrophilic
NLS Segment(s)
PositionSequence
6-16KRPHKRKSKAA
Subcellular Location(s) mito 14.5, cyto_mito 10.166, nucl 8, cyto_nucl 7.333, cyto 4.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_329475  -  
Amino Acid Sequences MALMPKRPHKRKSKAAASVRLPPQPPPLITPAPVAPLLGHIPHLLTPSAFSQDTRMYGNPNIKLTPSQPYVVPSQHQHGFDDLSIDPALQAGEQQLAPTLHQDRYVSLGSYCCVVCFGSQTIFPLKQFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.87
4 0.81
5 0.8
6 0.75
7 0.7
8 0.6
9 0.53
10 0.5
11 0.45
12 0.42
13 0.36
14 0.37
15 0.33
16 0.33
17 0.32
18 0.26
19 0.24
20 0.23
21 0.19
22 0.13
23 0.13
24 0.13
25 0.11
26 0.11
27 0.08
28 0.09
29 0.1
30 0.11
31 0.09
32 0.08
33 0.09
34 0.09
35 0.12
36 0.12
37 0.11
38 0.12
39 0.13
40 0.15
41 0.16
42 0.15
43 0.15
44 0.18
45 0.23
46 0.22
47 0.22
48 0.21
49 0.19
50 0.2
51 0.19
52 0.21
53 0.18
54 0.17
55 0.16
56 0.17
57 0.2
58 0.2
59 0.2
60 0.17
61 0.2
62 0.23
63 0.23
64 0.22
65 0.2
66 0.2
67 0.18
68 0.19
69 0.14
70 0.12
71 0.11
72 0.1
73 0.09
74 0.08
75 0.08
76 0.05
77 0.06
78 0.04
79 0.06
80 0.06
81 0.06
82 0.09
83 0.09
84 0.1
85 0.14
86 0.16
87 0.16
88 0.18
89 0.19
90 0.17
91 0.21
92 0.22
93 0.19
94 0.16
95 0.17
96 0.15
97 0.16
98 0.15
99 0.11
100 0.11
101 0.1
102 0.1
103 0.12
104 0.14
105 0.14
106 0.15
107 0.18
108 0.23
109 0.25