Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4K3Y8

Protein Details
Accession W4K3Y8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
177-205SSPAASSGRVQKKRRRGPRARAPPLFEREHydrophilic
NLS Segment(s)
PositionSequence
68-76RKAAKRKMG
185-199RVQKKRRRGPRARAP
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG hir:HETIRDRAFT_33335  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MAKKSKDEVPNPNSVANRDILQRLNFLYQASAYLSTMPNATASSSTQSAETRPQPPLPEYSSSIHPQRKAAKRKMGVGRKLGVEEIARAYVRQMKQIGQKTTVKMDPTVKRTFCQGCDSVLVPVVSAVVRVHTSSTHGHLVNTTCLRCKTSRRIPAPPIQEPDIYEPPDGHTMTMASSPAASSGRVQKKRRRGPRARAPPLFEREGHVVFRGNERLEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.44
3 0.35
4 0.32
5 0.26
6 0.27
7 0.27
8 0.27
9 0.27
10 0.27
11 0.28
12 0.26
13 0.23
14 0.2
15 0.16
16 0.16
17 0.15
18 0.14
19 0.12
20 0.13
21 0.13
22 0.13
23 0.13
24 0.12
25 0.11
26 0.1
27 0.1
28 0.09
29 0.1
30 0.13
31 0.13
32 0.13
33 0.14
34 0.15
35 0.16
36 0.21
37 0.25
38 0.25
39 0.28
40 0.3
41 0.31
42 0.32
43 0.35
44 0.32
45 0.31
46 0.31
47 0.3
48 0.32
49 0.33
50 0.39
51 0.39
52 0.36
53 0.38
54 0.44
55 0.51
56 0.57
57 0.62
58 0.64
59 0.63
60 0.7
61 0.74
62 0.74
63 0.7
64 0.65
65 0.59
66 0.51
67 0.48
68 0.39
69 0.31
70 0.22
71 0.17
72 0.13
73 0.12
74 0.1
75 0.09
76 0.1
77 0.15
78 0.15
79 0.18
80 0.18
81 0.21
82 0.28
83 0.35
84 0.37
85 0.35
86 0.38
87 0.36
88 0.38
89 0.36
90 0.3
91 0.25
92 0.3
93 0.31
94 0.33
95 0.37
96 0.34
97 0.32
98 0.37
99 0.36
100 0.31
101 0.3
102 0.25
103 0.2
104 0.21
105 0.21
106 0.17
107 0.16
108 0.14
109 0.1
110 0.09
111 0.08
112 0.06
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.06
119 0.06
120 0.09
121 0.1
122 0.13
123 0.16
124 0.16
125 0.16
126 0.18
127 0.19
128 0.21
129 0.23
130 0.21
131 0.2
132 0.2
133 0.24
134 0.25
135 0.3
136 0.35
137 0.42
138 0.52
139 0.55
140 0.62
141 0.65
142 0.7
143 0.7
144 0.66
145 0.6
146 0.53
147 0.48
148 0.42
149 0.43
150 0.4
151 0.34
152 0.28
153 0.24
154 0.24
155 0.27
156 0.25
157 0.18
158 0.14
159 0.13
160 0.13
161 0.14
162 0.12
163 0.08
164 0.07
165 0.07
166 0.09
167 0.09
168 0.09
169 0.11
170 0.21
171 0.31
172 0.4
173 0.48
174 0.56
175 0.66
176 0.76
177 0.84
178 0.86
179 0.86
180 0.88
181 0.91
182 0.94
183 0.93
184 0.89
185 0.85
186 0.82
187 0.78
188 0.71
189 0.6
190 0.54
191 0.49
192 0.45
193 0.4
194 0.33
195 0.31
196 0.28
197 0.34
198 0.34
199 0.3