Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4K7R5

Protein Details
Accession W4K7R5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
159-180EPPSNQPKRPRLTQTARKSTGGHydrophilic
NLS Segment(s)
PositionSequence
175-186RKSTGGAPPRRK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR000164  Histone_H3/CENP-A  
Gene Ontology GO:0000786  C:nucleosome  
GO:0003677  F:DNA binding  
GO:0030527  F:structural constituent of chromatin  
KEGG hir:HETIRDRAFT_318391  -  
Amino Acid Sequences MSHPNCYLSSRSQISSATPSGHQSYYASEDLNESDNLYSTDKVQDNNYIFRNFTPRTKQTARKTTGGRAPKRQPQSSSNRSLPPLSEMSSPSLEALEPFRNQPLSSGGEDQTPSTSKPRDNQTARKSTGSRPPRPKPAVTHTASAPPPNVSTPSSWNAEPPSNQPKRPRLTQTARKSTGGAPPRRKTSHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.32
4 0.27
5 0.24
6 0.27
7 0.28
8 0.27
9 0.25
10 0.2
11 0.21
12 0.24
13 0.23
14 0.2
15 0.17
16 0.18
17 0.18
18 0.19
19 0.16
20 0.12
21 0.11
22 0.12
23 0.13
24 0.14
25 0.13
26 0.12
27 0.18
28 0.18
29 0.2
30 0.21
31 0.26
32 0.27
33 0.32
34 0.34
35 0.29
36 0.28
37 0.28
38 0.34
39 0.29
40 0.32
41 0.36
42 0.36
43 0.43
44 0.5
45 0.58
46 0.6
47 0.68
48 0.67
49 0.65
50 0.64
51 0.62
52 0.63
53 0.63
54 0.59
55 0.58
56 0.61
57 0.62
58 0.67
59 0.64
60 0.61
61 0.59
62 0.64
63 0.62
64 0.62
65 0.58
66 0.53
67 0.5
68 0.46
69 0.39
70 0.32
71 0.26
72 0.2
73 0.18
74 0.16
75 0.17
76 0.17
77 0.16
78 0.13
79 0.11
80 0.09
81 0.08
82 0.1
83 0.1
84 0.1
85 0.1
86 0.11
87 0.12
88 0.12
89 0.12
90 0.13
91 0.13
92 0.14
93 0.16
94 0.15
95 0.16
96 0.17
97 0.16
98 0.14
99 0.13
100 0.12
101 0.14
102 0.16
103 0.18
104 0.23
105 0.3
106 0.38
107 0.43
108 0.52
109 0.57
110 0.63
111 0.63
112 0.63
113 0.59
114 0.54
115 0.58
116 0.58
117 0.59
118 0.6
119 0.65
120 0.7
121 0.72
122 0.71
123 0.68
124 0.67
125 0.66
126 0.59
127 0.55
128 0.46
129 0.48
130 0.44
131 0.39
132 0.32
133 0.24
134 0.23
135 0.22
136 0.23
137 0.17
138 0.18
139 0.22
140 0.24
141 0.26
142 0.25
143 0.26
144 0.27
145 0.3
146 0.3
147 0.32
148 0.39
149 0.43
150 0.48
151 0.55
152 0.6
153 0.63
154 0.69
155 0.7
156 0.7
157 0.74
158 0.79
159 0.81
160 0.83
161 0.8
162 0.73
163 0.67
164 0.61
165 0.59
166 0.59
167 0.58
168 0.57
169 0.61
170 0.69