Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KMI8

Protein Details
Accession W4KMI8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-84GPGGRGEKVRLRRENRQRIRDQNFMKBasic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG hir:HETIRDRAFT_311195  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences ACACVRAGTTGSRSMCPPNAVLAGLQWLKNQPPVLALADDAYPGWLWTLLDAKKVEDDGPGGRGEKVRLRRENRQRIRDQNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.29
4 0.27
5 0.23
6 0.22
7 0.21
8 0.19
9 0.14
10 0.16
11 0.16
12 0.16
13 0.14
14 0.14
15 0.15
16 0.18
17 0.18
18 0.13
19 0.13
20 0.14
21 0.14
22 0.13
23 0.12
24 0.09
25 0.09
26 0.09
27 0.08
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.03
34 0.04
35 0.09
36 0.09
37 0.13
38 0.13
39 0.14
40 0.14
41 0.15
42 0.15
43 0.11
44 0.13
45 0.1
46 0.11
47 0.12
48 0.12
49 0.13
50 0.14
51 0.16
52 0.22
53 0.3
54 0.38
55 0.46
56 0.52
57 0.62
58 0.72
59 0.8
60 0.83
61 0.84
62 0.84
63 0.86
64 0.86
65 0.85
66 0.8