Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4K0I8

Protein Details
Accession W4K0I8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
16-44AYVEHRSRRTMRSKRRKTALRLTVKKELSHydrophilic
NLS Segment(s)
PositionSequence
23-33RRTMRSKRRKT
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
KEGG hir:HETIRDRAFT_324255  -  
Amino Acid Sequences MVEADSDHSDSGDDGAYVEHRSRRTMRSKRRKTALRLTVKKELSPSPTSSSPFTLSIQPLQDALTSRYAAEEAMDSSFDEIIGPLLSDYMRVKTEIETRSERDEYGRPILLLSPQDEETFIERLEKRRVSSEYGLDTNDALILRKLKLQRVRHSFSYCRLIIHHVLLLCRSVAPMDSYTLSSVRHSHPHSPHYLLPTVRQQPIHRPSTPSTPSELLLSSFPSFHVCTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.11
5 0.14
6 0.18
7 0.19
8 0.25
9 0.29
10 0.37
11 0.47
12 0.56
13 0.64
14 0.7
15 0.8
16 0.84
17 0.9
18 0.9
19 0.88
20 0.88
21 0.87
22 0.87
23 0.85
24 0.81
25 0.8
26 0.73
27 0.66
28 0.59
29 0.53
30 0.48
31 0.44
32 0.41
33 0.37
34 0.39
35 0.39
36 0.37
37 0.35
38 0.31
39 0.29
40 0.27
41 0.26
42 0.24
43 0.25
44 0.24
45 0.22
46 0.2
47 0.18
48 0.18
49 0.16
50 0.16
51 0.15
52 0.14
53 0.14
54 0.14
55 0.13
56 0.12
57 0.1
58 0.08
59 0.06
60 0.07
61 0.07
62 0.06
63 0.07
64 0.07
65 0.06
66 0.06
67 0.05
68 0.05
69 0.04
70 0.04
71 0.03
72 0.04
73 0.04
74 0.05
75 0.06
76 0.07
77 0.08
78 0.09
79 0.09
80 0.11
81 0.18
82 0.19
83 0.23
84 0.24
85 0.26
86 0.3
87 0.3
88 0.28
89 0.24
90 0.25
91 0.23
92 0.23
93 0.21
94 0.17
95 0.16
96 0.16
97 0.15
98 0.14
99 0.12
100 0.1
101 0.1
102 0.11
103 0.11
104 0.11
105 0.11
106 0.11
107 0.1
108 0.13
109 0.13
110 0.17
111 0.23
112 0.24
113 0.23
114 0.27
115 0.29
116 0.3
117 0.31
118 0.31
119 0.28
120 0.27
121 0.27
122 0.22
123 0.2
124 0.15
125 0.13
126 0.1
127 0.07
128 0.07
129 0.09
130 0.09
131 0.13
132 0.16
133 0.22
134 0.3
135 0.38
136 0.46
137 0.53
138 0.58
139 0.6
140 0.63
141 0.6
142 0.56
143 0.55
144 0.46
145 0.39
146 0.34
147 0.33
148 0.29
149 0.27
150 0.25
151 0.18
152 0.18
153 0.18
154 0.17
155 0.13
156 0.11
157 0.09
158 0.07
159 0.07
160 0.09
161 0.09
162 0.11
163 0.12
164 0.12
165 0.14
166 0.14
167 0.14
168 0.14
169 0.17
170 0.18
171 0.25
172 0.28
173 0.36
174 0.41
175 0.46
176 0.49
177 0.49
178 0.5
179 0.47
180 0.48
181 0.41
182 0.39
183 0.43
184 0.45
185 0.44
186 0.46
187 0.44
188 0.49
189 0.57
190 0.59
191 0.53
192 0.52
193 0.52
194 0.57
195 0.58
196 0.5
197 0.47
198 0.42
199 0.4
200 0.36
201 0.33
202 0.25
203 0.21
204 0.23
205 0.18
206 0.16
207 0.16
208 0.18