Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K034

Protein Details
Accession W4K034    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
138-159LYTSRPAPPPPKKPQPPPVTHSHydrophilic
NLS Segment(s)
PositionSequence
267-278TPRRREKKEKDK
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
IPR036936  CRIB_dom_sf  
IPR011009  Kinase-like_dom_sf  
IPR033923  PAK_BD  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
KEGG hir:HETIRDRAFT_64508  -  
Pfam View protein in Pfam  
PF00786  PBD  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50108  CRIB  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd01093  CRIB_PAK_like  
cd06614  STKc_PAK  
Amino Acid Sequences MPPSVPPTPTVGPDRPSIGNRSRSGTATKGKKGMLGFMSDFLNSSKRPEISTPYDPVHLTHVGFNSSTGEFTGLPKEWQQLLQDSGISKLDQEKNPLAVMEIVKFYQEGGGDVWDKMGHAPAPIGGTPQQPKPIDESLYTSRPAPPPPKKPQPPPVTHSASVPAPSPTAFRPAPTPPTPASPNLDRSTSQRTTPKPPRGDSLGRSNTTKDRRSPGPGTPHHAHSQTQGTPGAIPNFTPPGPTPDRARAPAQPSPAASSLAKAAGVATPRRREKKEKDKDKEADIVKRLQQICTDADPTRLYRSLVKIGQGASGGVFTAYQVGTNMSVAIKQMDLDKQPKKDLIINEILVMRASRHPNIVNYIDSFLYKNELWVVMEYMEGGSLTDVVTANLMTEGQIAAVSRETAQGLQHLHKHGVIHRDIKSDNVLLSMTGDIKLTDFGFCAQISDPAHAKRTTMVGTPYWMAPEVVTRKEYGPKVDIWSLGIMAIEMIEGEPPYLNQNPLKALYLIATNGTPTIANPESLSPVFRDYLAKTLEVDAEKRPDAAQLLQHPFFAGAEPLRTLAPLIKAARDIAKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.41
4 0.44
5 0.45
6 0.49
7 0.49
8 0.51
9 0.5
10 0.48
11 0.49
12 0.49
13 0.5
14 0.5
15 0.54
16 0.54
17 0.51
18 0.53
19 0.49
20 0.49
21 0.42
22 0.38
23 0.33
24 0.3
25 0.3
26 0.25
27 0.25
28 0.2
29 0.22
30 0.17
31 0.2
32 0.24
33 0.24
34 0.27
35 0.3
36 0.37
37 0.4
38 0.46
39 0.46
40 0.43
41 0.45
42 0.42
43 0.39
44 0.36
45 0.31
46 0.26
47 0.25
48 0.24
49 0.23
50 0.22
51 0.22
52 0.2
53 0.17
54 0.17
55 0.13
56 0.13
57 0.12
58 0.14
59 0.18
60 0.16
61 0.18
62 0.2
63 0.24
64 0.23
65 0.25
66 0.27
67 0.25
68 0.27
69 0.26
70 0.25
71 0.22
72 0.22
73 0.21
74 0.18
75 0.15
76 0.21
77 0.28
78 0.28
79 0.34
80 0.35
81 0.36
82 0.36
83 0.35
84 0.27
85 0.23
86 0.22
87 0.18
88 0.16
89 0.15
90 0.14
91 0.14
92 0.13
93 0.11
94 0.1
95 0.09
96 0.08
97 0.11
98 0.13
99 0.13
100 0.13
101 0.11
102 0.11
103 0.11
104 0.12
105 0.1
106 0.09
107 0.09
108 0.1
109 0.12
110 0.12
111 0.14
112 0.14
113 0.19
114 0.22
115 0.25
116 0.31
117 0.3
118 0.31
119 0.34
120 0.36
121 0.32
122 0.3
123 0.33
124 0.31
125 0.33
126 0.33
127 0.28
128 0.29
129 0.3
130 0.35
131 0.39
132 0.43
133 0.51
134 0.6
135 0.69
136 0.73
137 0.8
138 0.83
139 0.83
140 0.81
141 0.76
142 0.75
143 0.71
144 0.63
145 0.55
146 0.48
147 0.39
148 0.33
149 0.29
150 0.21
151 0.14
152 0.14
153 0.15
154 0.13
155 0.18
156 0.17
157 0.17
158 0.2
159 0.23
160 0.3
161 0.3
162 0.34
163 0.29
164 0.34
165 0.36
166 0.35
167 0.36
168 0.32
169 0.36
170 0.34
171 0.35
172 0.3
173 0.31
174 0.37
175 0.34
176 0.35
177 0.35
178 0.38
179 0.46
180 0.55
181 0.6
182 0.58
183 0.58
184 0.58
185 0.59
186 0.6
187 0.53
188 0.54
189 0.52
190 0.47
191 0.46
192 0.44
193 0.45
194 0.47
195 0.48
196 0.42
197 0.41
198 0.43
199 0.49
200 0.5
201 0.49
202 0.51
203 0.5
204 0.53
205 0.5
206 0.5
207 0.46
208 0.43
209 0.38
210 0.31
211 0.33
212 0.27
213 0.26
214 0.23
215 0.2
216 0.19
217 0.2
218 0.19
219 0.13
220 0.12
221 0.12
222 0.13
223 0.13
224 0.13
225 0.12
226 0.17
227 0.2
228 0.22
229 0.24
230 0.29
231 0.32
232 0.34
233 0.36
234 0.34
235 0.36
236 0.37
237 0.37
238 0.31
239 0.29
240 0.29
241 0.27
242 0.24
243 0.19
244 0.16
245 0.14
246 0.12
247 0.11
248 0.08
249 0.07
250 0.07
251 0.09
252 0.12
253 0.16
254 0.23
255 0.29
256 0.36
257 0.4
258 0.47
259 0.56
260 0.63
261 0.7
262 0.74
263 0.75
264 0.79
265 0.78
266 0.72
267 0.69
268 0.61
269 0.56
270 0.47
271 0.43
272 0.36
273 0.39
274 0.36
275 0.29
276 0.27
277 0.23
278 0.23
279 0.21
280 0.22
281 0.16
282 0.17
283 0.18
284 0.18
285 0.18
286 0.17
287 0.16
288 0.16
289 0.18
290 0.22
291 0.22
292 0.22
293 0.21
294 0.2
295 0.2
296 0.17
297 0.15
298 0.09
299 0.08
300 0.06
301 0.05
302 0.04
303 0.03
304 0.04
305 0.04
306 0.04
307 0.04
308 0.05
309 0.05
310 0.06
311 0.06
312 0.05
313 0.05
314 0.05
315 0.06
316 0.05
317 0.05
318 0.07
319 0.09
320 0.13
321 0.2
322 0.24
323 0.26
324 0.28
325 0.29
326 0.29
327 0.32
328 0.3
329 0.29
330 0.29
331 0.26
332 0.26
333 0.25
334 0.23
335 0.18
336 0.16
337 0.12
338 0.12
339 0.15
340 0.15
341 0.17
342 0.19
343 0.2
344 0.25
345 0.25
346 0.21
347 0.2
348 0.2
349 0.18
350 0.17
351 0.16
352 0.12
353 0.13
354 0.11
355 0.11
356 0.1
357 0.1
358 0.1
359 0.1
360 0.11
361 0.08
362 0.08
363 0.07
364 0.06
365 0.06
366 0.05
367 0.04
368 0.03
369 0.03
370 0.03
371 0.04
372 0.05
373 0.05
374 0.05
375 0.05
376 0.05
377 0.05
378 0.05
379 0.04
380 0.04
381 0.04
382 0.04
383 0.04
384 0.04
385 0.05
386 0.05
387 0.06
388 0.06
389 0.07
390 0.07
391 0.08
392 0.08
393 0.11
394 0.13
395 0.16
396 0.2
397 0.21
398 0.22
399 0.23
400 0.25
401 0.25
402 0.3
403 0.31
404 0.33
405 0.34
406 0.37
407 0.35
408 0.35
409 0.34
410 0.28
411 0.24
412 0.18
413 0.16
414 0.12
415 0.12
416 0.11
417 0.09
418 0.08
419 0.08
420 0.07
421 0.08
422 0.09
423 0.09
424 0.08
425 0.08
426 0.08
427 0.1
428 0.1
429 0.11
430 0.1
431 0.14
432 0.15
433 0.17
434 0.2
435 0.21
436 0.25
437 0.24
438 0.24
439 0.21
440 0.24
441 0.23
442 0.22
443 0.23
444 0.2
445 0.22
446 0.23
447 0.22
448 0.19
449 0.18
450 0.15
451 0.12
452 0.18
453 0.2
454 0.21
455 0.22
456 0.22
457 0.24
458 0.32
459 0.34
460 0.31
461 0.3
462 0.3
463 0.35
464 0.36
465 0.34
466 0.28
467 0.26
468 0.21
469 0.19
470 0.16
471 0.1
472 0.07
473 0.06
474 0.04
475 0.04
476 0.03
477 0.04
478 0.04
479 0.05
480 0.05
481 0.06
482 0.1
483 0.13
484 0.16
485 0.17
486 0.2
487 0.23
488 0.25
489 0.27
490 0.23
491 0.21
492 0.19
493 0.19
494 0.17
495 0.15
496 0.13
497 0.11
498 0.11
499 0.11
500 0.09
501 0.08
502 0.14
503 0.14
504 0.15
505 0.15
506 0.17
507 0.21
508 0.21
509 0.23
510 0.17
511 0.19
512 0.19
513 0.19
514 0.22
515 0.19
516 0.25
517 0.25
518 0.24
519 0.23
520 0.24
521 0.28
522 0.26
523 0.27
524 0.25
525 0.29
526 0.29
527 0.29
528 0.27
529 0.24
530 0.25
531 0.26
532 0.28
533 0.32
534 0.39
535 0.39
536 0.38
537 0.36
538 0.34
539 0.31
540 0.25
541 0.2
542 0.14
543 0.15
544 0.16
545 0.16
546 0.16
547 0.16
548 0.16
549 0.16
550 0.17
551 0.22
552 0.23
553 0.24
554 0.26
555 0.29
556 0.34