Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1H7L4

Protein Details
Accession C1H7L4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
54-75GKGKGKGKGKGKKIYVRANQSDBasic
NLS Segment(s)
PositionSequence
55-66KGKGKGKGKGKK
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 6, cyto 6
Family & Domain DBs
KEGG pbl:PAAG_06755  -  
Amino Acid Sequences MAIHTATPAQSTERGAGEEFSVLAGHTGYWSRYPQQIRSYIPQPSFQPLHCDGGKGKGKGKGKGKKIYVRANQSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.17
4 0.15
5 0.13
6 0.11
7 0.08
8 0.07
9 0.06
10 0.06
11 0.05
12 0.04
13 0.05
14 0.06
15 0.06
16 0.08
17 0.1
18 0.11
19 0.17
20 0.2
21 0.23
22 0.28
23 0.31
24 0.32
25 0.35
26 0.37
27 0.36
28 0.35
29 0.34
30 0.3
31 0.31
32 0.3
33 0.26
34 0.28
35 0.26
36 0.3
37 0.27
38 0.27
39 0.23
40 0.31
41 0.37
42 0.33
43 0.35
44 0.37
45 0.42
46 0.48
47 0.58
48 0.58
49 0.6
50 0.68
51 0.73
52 0.75
53 0.78
54 0.8
55 0.8