Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4JPJ1

Protein Details
Accession W4JPJ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-22GGYRHRVSRHRVYRKHHLSGCBasic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
KEGG hir:HETIRDRAFT_331453  -  
Amino Acid Sequences MGGYRHRVSRHRVYRKHHLSGCQLSWVPAMPFVNLALQVTTCDFSGYECPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.82
4 0.75
5 0.69
6 0.66
7 0.64
8 0.56
9 0.49
10 0.41
11 0.32
12 0.29
13 0.24
14 0.16
15 0.13
16 0.13
17 0.09
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.07
24 0.07
25 0.07
26 0.09
27 0.09
28 0.08
29 0.09
30 0.08
31 0.1