Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4K013

Protein Details
Accession W4K013    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-37TKSHTLCRRCGRRAFHKQHKECAQCHydrophilic
NLS Segment(s)
PositionSequence
53-57AKRRK
Subcellular Location(s) nucl 9, mito 9, cyto 9, cyto_nucl 9, cyto_mito 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG hir:HETIRDRAFT_410943  -  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHTKSHTLCRRCGRRAFHKQHKECAQCGYPAAKLRSYEWGQKAKRRKTTGTGRMRYLKTVSRRFKNGFRENTVAKKVVRAATSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.71
4 0.67
5 0.73
6 0.77
7 0.78
8 0.75
9 0.77
10 0.75
11 0.75
12 0.79
13 0.81
14 0.82
15 0.84
16 0.81
17 0.83
18 0.83
19 0.76
20 0.66
21 0.61
22 0.52
23 0.42
24 0.39
25 0.32
26 0.25
27 0.27
28 0.27
29 0.23
30 0.22
31 0.22
32 0.27
33 0.27
34 0.3
35 0.3
36 0.37
37 0.38
38 0.44
39 0.53
40 0.55
41 0.61
42 0.6
43 0.58
44 0.59
45 0.67
46 0.7
47 0.71
48 0.67
49 0.64
50 0.67
51 0.64
52 0.58
53 0.51
54 0.47
55 0.46
56 0.52
57 0.55
58 0.55
59 0.61
60 0.63
61 0.68
62 0.72
63 0.72
64 0.69
65 0.67
66 0.66
67 0.63
68 0.66
69 0.63
70 0.56
71 0.47
72 0.44
73 0.43
74 0.42
75 0.39