Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4K622

Protein Details
Accession W4K622   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-50GTRERTHAASDRRRRRRLRRGKLRLQHGDGBasic
NLS Segment(s)
PositionSequence
8-44RRAWARGDGRGLEGTRERTHAASDRRRRRRLRRGKLR
Subcellular Location(s) mito 14, nucl 8, cyto 4
Family & Domain DBs
KEGG hir:HETIRDRAFT_433973  -  
Amino Acid Sequences MDSKAGARRAWARGDGRGLEGTRERTHAASDRRRRRRLRRGKLRLQHGDGALRGSLSGVELARGLEQRFEPGGNSINTLLRHGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.35
4 0.35
5 0.31
6 0.28
7 0.28
8 0.29
9 0.25
10 0.26
11 0.25
12 0.22
13 0.24
14 0.28
15 0.33
16 0.39
17 0.48
18 0.56
19 0.65
20 0.74
21 0.8
22 0.84
23 0.87
24 0.88
25 0.89
26 0.89
27 0.89
28 0.9
29 0.88
30 0.87
31 0.82
32 0.74
33 0.66
34 0.55
35 0.47
36 0.38
37 0.31
38 0.22
39 0.15
40 0.12
41 0.08
42 0.07
43 0.05
44 0.06
45 0.05
46 0.05
47 0.06
48 0.06
49 0.08
50 0.1
51 0.1
52 0.11
53 0.11
54 0.14
55 0.15
56 0.15
57 0.14
58 0.15
59 0.19
60 0.18
61 0.2
62 0.18
63 0.21
64 0.22
65 0.25