Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W4KJ70

Protein Details
Accession W4KJ70    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKRKKSSRKPAPSRKKDPLDTTFBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRKPAPSRKK
Subcellular Location(s) mito 19, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG hir:HETIRDRAFT_244379  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPAPSRKKDPLDTTFTCLFCHHDNSVTVKVDRKEGLAQLMCRVCDQRYQSKVNHLTEPIDIYSEWIDAADSAEKEQQVVRRPAASSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.91
4 0.86
5 0.83
6 0.78
7 0.75
8 0.67
9 0.63
10 0.58
11 0.49
12 0.42
13 0.35
14 0.32
15 0.26
16 0.27
17 0.22
18 0.2
19 0.21
20 0.25
21 0.28
22 0.27
23 0.26
24 0.26
25 0.26
26 0.26
27 0.25
28 0.22
29 0.2
30 0.18
31 0.21
32 0.19
33 0.18
34 0.19
35 0.2
36 0.18
37 0.17
38 0.17
39 0.14
40 0.17
41 0.21
42 0.25
43 0.29
44 0.33
45 0.34
46 0.43
47 0.49
48 0.47
49 0.46
50 0.39
51 0.35
52 0.32
53 0.32
54 0.23
55 0.17
56 0.14
57 0.12
58 0.12
59 0.1
60 0.09
61 0.07
62 0.07
63 0.06
64 0.08
65 0.09
66 0.09
67 0.11
68 0.13
69 0.13
70 0.14
71 0.17
72 0.21
73 0.27
74 0.32
75 0.33
76 0.34