Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JYM1

Protein Details
Accession W4JYM1   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-75DGYVPFKPRGKPKQPIKAIPPPKPRBasic
NLS Segment(s)
PositionSequence
57-75KPRGKPKQPIKAIPPPKPR
Subcellular Location(s) cyto_nucl 11.833, nucl 10, cyto 9.5, cyto_pero 7.332, pero 3.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_107590  -  
Amino Acid Sequences MSAAEETPPKVADERDELHGGIDPAQDQPAHTASTASDGEPANLPKPPVTDGYVPFKPRGKPKQPIKAIPPPKPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.26
4 0.25
5 0.24
6 0.24
7 0.21
8 0.16
9 0.14
10 0.1
11 0.09
12 0.1
13 0.1
14 0.08
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.08
21 0.12
22 0.12
23 0.1
24 0.11
25 0.11
26 0.11
27 0.13
28 0.14
29 0.11
30 0.12
31 0.12
32 0.1
33 0.11
34 0.13
35 0.13
36 0.16
37 0.19
38 0.21
39 0.28
40 0.32
41 0.32
42 0.34
43 0.37
44 0.39
45 0.45
46 0.53
47 0.55
48 0.6
49 0.69
50 0.77
51 0.81
52 0.84
53 0.82
54 0.83
55 0.83