Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JPK7

Protein Details
Accession W4JPK7   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-28VGTPLRRRRRVGKAGAPRVKEBasic
NLS Segment(s)
PositionSequence
13-25RRRRRVGKAGAPR
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
KEGG hir:HETIRDRAFT_442718  -  
Amino Acid Sequences MTQQARLVGTPLRRRRRVGKAGAPRVKEAELEFAYNQATLANLRVLFTRPCDDPTRDSRLTTIALLAVDSPYRTCCACDADGRCYALLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.74
4 0.76
5 0.75
6 0.75
7 0.75
8 0.81
9 0.82
10 0.75
11 0.66
12 0.59
13 0.51
14 0.42
15 0.31
16 0.27
17 0.21
18 0.21
19 0.19
20 0.17
21 0.16
22 0.15
23 0.14
24 0.07
25 0.07
26 0.05
27 0.06
28 0.06
29 0.06
30 0.07
31 0.07
32 0.09
33 0.09
34 0.11
35 0.13
36 0.12
37 0.16
38 0.19
39 0.21
40 0.25
41 0.3
42 0.36
43 0.34
44 0.34
45 0.31
46 0.29
47 0.28
48 0.24
49 0.19
50 0.11
51 0.1
52 0.1
53 0.09
54 0.08
55 0.07
56 0.07
57 0.08
58 0.08
59 0.1
60 0.1
61 0.11
62 0.12
63 0.17
64 0.19
65 0.26
66 0.29
67 0.33
68 0.36
69 0.37