Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W4JNM5

Protein Details
Accession W4JNM5   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-37GTKVRASRPHPSRPPVPRRPVPRRPVPRPCACTSHydrophilic
NLS Segment(s)
PositionSequence
8-28RASRPHPSRPPVPRRPVPRRP
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
KEGG hir:HETIRDRAFT_330653  -  
Amino Acid Sequences MPSGTKVRASRPHPSRPPVPRRPVPRRPVPRPCACTSLPHVPSPDMQPRQPFFFPLPPTPLTPDRSRTPPCASPPAFRHNLHSQPFHPSYLPPARPMTGCNPLASSMSALAISPAPPSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.76
4 0.81
5 0.81
6 0.82
7 0.8
8 0.82
9 0.85
10 0.86
11 0.84
12 0.84
13 0.84
14 0.85
15 0.87
16 0.85
17 0.85
18 0.81
19 0.76
20 0.71
21 0.61
22 0.56
23 0.51
24 0.52
25 0.45
26 0.4
27 0.38
28 0.33
29 0.34
30 0.34
31 0.37
32 0.3
33 0.3
34 0.34
35 0.34
36 0.38
37 0.36
38 0.33
39 0.27
40 0.29
41 0.31
42 0.27
43 0.29
44 0.26
45 0.26
46 0.28
47 0.29
48 0.27
49 0.26
50 0.28
51 0.27
52 0.32
53 0.34
54 0.35
55 0.37
56 0.38
57 0.4
58 0.44
59 0.43
60 0.43
61 0.44
62 0.47
63 0.47
64 0.43
65 0.46
66 0.44
67 0.49
68 0.47
69 0.47
70 0.4
71 0.43
72 0.45
73 0.4
74 0.34
75 0.26
76 0.31
77 0.36
78 0.36
79 0.31
80 0.32
81 0.33
82 0.32
83 0.35
84 0.33
85 0.33
86 0.32
87 0.3
88 0.28
89 0.28
90 0.28
91 0.26
92 0.21
93 0.13
94 0.12
95 0.12
96 0.1
97 0.1
98 0.1
99 0.09
100 0.09