Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7PTP9

Protein Details
Accession S7PTP9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
193-212RVHCHVRPLRRWPGERQRGYBasic
NLS Segment(s)
PositionSequence
81-94RRPTKARRAPPPPP
Subcellular Location(s) mito 15, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_112687  -  
Amino Acid Sequences MQKAAMASITAPRHTIHTIHGSLAGKPLLWDAPLSGLPHHKPNHPPRSSTSAPPRISVSFPTSPFSPSESEAEALSWKVVRRPTKARRAPPPPPASVKAKADMDAALDPFADEMTEYVTLDAPIEIHIHPAPSIPPAPSPSPSPPSHSLPSPSFSAPSPSPLYQPPGLACPPPDPAKEHAARLKFVAGMLMYRVHCHVRPLRRWPGERQRGYVRSGLSRVVAVGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.23
4 0.27
5 0.28
6 0.27
7 0.32
8 0.3
9 0.28
10 0.31
11 0.26
12 0.18
13 0.17
14 0.18
15 0.13
16 0.13
17 0.12
18 0.09
19 0.12
20 0.14
21 0.15
22 0.15
23 0.2
24 0.22
25 0.29
26 0.32
27 0.34
28 0.42
29 0.52
30 0.61
31 0.58
32 0.59
33 0.57
34 0.63
35 0.6
36 0.59
37 0.59
38 0.57
39 0.55
40 0.53
41 0.51
42 0.44
43 0.42
44 0.37
45 0.33
46 0.29
47 0.29
48 0.3
49 0.28
50 0.27
51 0.26
52 0.25
53 0.21
54 0.17
55 0.19
56 0.17
57 0.17
58 0.16
59 0.15
60 0.13
61 0.11
62 0.1
63 0.09
64 0.09
65 0.12
66 0.17
67 0.22
68 0.27
69 0.38
70 0.46
71 0.56
72 0.64
73 0.68
74 0.72
75 0.76
76 0.77
77 0.76
78 0.72
79 0.65
80 0.62
81 0.58
82 0.54
83 0.5
84 0.44
85 0.38
86 0.33
87 0.3
88 0.25
89 0.22
90 0.18
91 0.14
92 0.12
93 0.08
94 0.07
95 0.06
96 0.06
97 0.05
98 0.04
99 0.03
100 0.02
101 0.04
102 0.04
103 0.04
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.06
112 0.06
113 0.07
114 0.08
115 0.08
116 0.08
117 0.08
118 0.08
119 0.09
120 0.1
121 0.09
122 0.1
123 0.13
124 0.15
125 0.16
126 0.19
127 0.22
128 0.26
129 0.27
130 0.31
131 0.32
132 0.36
133 0.37
134 0.35
135 0.36
136 0.32
137 0.33
138 0.3
139 0.26
140 0.22
141 0.2
142 0.23
143 0.19
144 0.22
145 0.23
146 0.21
147 0.23
148 0.24
149 0.29
150 0.25
151 0.26
152 0.22
153 0.22
154 0.23
155 0.22
156 0.21
157 0.18
158 0.22
159 0.24
160 0.25
161 0.24
162 0.27
163 0.34
164 0.35
165 0.38
166 0.4
167 0.39
168 0.39
169 0.37
170 0.35
171 0.27
172 0.24
173 0.2
174 0.14
175 0.12
176 0.12
177 0.16
178 0.14
179 0.15
180 0.17
181 0.19
182 0.2
183 0.26
184 0.33
185 0.39
186 0.47
187 0.55
188 0.63
189 0.69
190 0.73
191 0.76
192 0.79
193 0.8
194 0.77
195 0.74
196 0.74
197 0.68
198 0.67
199 0.61
200 0.54
201 0.49
202 0.46
203 0.41
204 0.32
205 0.29