Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QLS7

Protein Details
Accession S7QLS7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-89EESETAKKRRAERRQSADKQNGGHydrophilic
NLS Segment(s)
PositionSequence
75-75R
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_124156  -  
Amino Acid Sequences MSDEIAQDEEDAEDYDLEALEHRTAARGHHDDDDDITLVGRRGPDSVADDGVVFEIGDDEQDASDVEESETAKKRRAERRQSADKQNGGHHEREGLMGAEDPKDRDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.07
6 0.07
7 0.07
8 0.08
9 0.08
10 0.1
11 0.1
12 0.12
13 0.18
14 0.2
15 0.22
16 0.25
17 0.26
18 0.24
19 0.25
20 0.25
21 0.18
22 0.15
23 0.13
24 0.1
25 0.09
26 0.09
27 0.08
28 0.07
29 0.07
30 0.07
31 0.09
32 0.11
33 0.12
34 0.11
35 0.11
36 0.1
37 0.1
38 0.09
39 0.08
40 0.05
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.04
52 0.05
53 0.04
54 0.06
55 0.07
56 0.11
57 0.18
58 0.18
59 0.24
60 0.28
61 0.37
62 0.46
63 0.56
64 0.63
65 0.67
66 0.76
67 0.81
68 0.85
69 0.87
70 0.84
71 0.78
72 0.7
73 0.65
74 0.64
75 0.57
76 0.51
77 0.41
78 0.36
79 0.32
80 0.3
81 0.26
82 0.18
83 0.14
84 0.15
85 0.16
86 0.16
87 0.17