Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7PV49

Protein Details
Accession S7PV49    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-28EMDACFSQKRRKAPRDPENVHPDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040521  KDZ  
KEGG gtr:GLOTRDRAFT_26774  -  
Pfam View protein in Pfam  
PF18758  KDZ  
Amino Acid Sequences EYIVEMDACFSQKRRKAPRDPENVHPDTVWLSEAKVKTMEEEVLRRRTQRSRAPPQGAPGPDKDGFEGSLKVPKSALDECKNTFTAADEKRQKASTQLFDDTGIMALNCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.58
3 0.67
4 0.76
5 0.83
6 0.85
7 0.84
8 0.83
9 0.82
10 0.74
11 0.64
12 0.53
13 0.43
14 0.34
15 0.29
16 0.21
17 0.11
18 0.1
19 0.14
20 0.14
21 0.15
22 0.14
23 0.14
24 0.14
25 0.15
26 0.17
27 0.14
28 0.19
29 0.23
30 0.27
31 0.29
32 0.29
33 0.32
34 0.36
35 0.41
36 0.45
37 0.5
38 0.54
39 0.62
40 0.65
41 0.62
42 0.59
43 0.57
44 0.5
45 0.42
46 0.33
47 0.29
48 0.25
49 0.24
50 0.22
51 0.17
52 0.16
53 0.16
54 0.15
55 0.11
56 0.15
57 0.15
58 0.15
59 0.14
60 0.14
61 0.17
62 0.21
63 0.27
64 0.28
65 0.31
66 0.33
67 0.37
68 0.37
69 0.33
70 0.28
71 0.23
72 0.26
73 0.25
74 0.33
75 0.37
76 0.39
77 0.43
78 0.45
79 0.43
80 0.43
81 0.48
82 0.46
83 0.43
84 0.44
85 0.41
86 0.4
87 0.4
88 0.33
89 0.25
90 0.18