Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7S4F6

Protein Details
Accession S7S4F6    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-35LLAVPKKKTSHSRKRMRSANKGLKDKHydrophilic
NLS Segment(s)
PositionSequence
15-31KKKTSHSRKRMRSANKG
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG gtr:GLOTRDRAFT_22635  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences SLLDLFPPFLLAVPKKKTSHSRKRMRSANKGLKDKLNLVHCPACGTPKLAHNLCPNCYSQLSRGWKQQMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.43
4 0.53
5 0.58
6 0.66
7 0.68
8 0.74
9 0.77
10 0.84
11 0.88
12 0.86
13 0.86
14 0.85
15 0.85
16 0.82
17 0.79
18 0.72
19 0.66
20 0.59
21 0.52
22 0.45
23 0.4
24 0.33
25 0.3
26 0.3
27 0.26
28 0.26
29 0.24
30 0.21
31 0.17
32 0.19
33 0.18
34 0.2
35 0.28
36 0.26
37 0.32
38 0.38
39 0.42
40 0.42
41 0.42
42 0.39
43 0.35
44 0.36
45 0.33
46 0.27
47 0.32
48 0.38
49 0.41
50 0.47