Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q4E6

Protein Details
Accession S7Q4E6    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
224-243WLDGEKQPRPKTPFRRDQKAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 11, nucl 9.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007361  DUF427  
IPR038694  DUF427_sf  
KEGG gtr:GLOTRDRAFT_130731  -  
Pfam View protein in Pfam  
PF04248  NTP_transf_9  
Amino Acid Sequences MSFTLPHVETSPKRVHVYFNDKCIVDTRNAKLVWEHPNYPVYYFVASDIPKEFLQEKAGTNTYDVVVEGRRAEGAATQFTQGDLKGLIKLAASAMDAWFEEDKQFTGHPKDPYKVRIDVLPSSRHVRVEVEGVEVANSQQPRLLFETGLITRYYIPRSDCRMDLLEPSELTTHCPYKGDANYFNVRLPNGKLVENVVWYYDSPYAECADVKGCLAFYDEKLDVWLDGEKQPRPKTPFRRDQKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.48
4 0.56
5 0.54
6 0.53
7 0.53
8 0.49
9 0.49
10 0.46
11 0.39
12 0.35
13 0.37
14 0.35
15 0.37
16 0.37
17 0.37
18 0.36
19 0.4
20 0.42
21 0.41
22 0.39
23 0.34
24 0.39
25 0.39
26 0.37
27 0.33
28 0.26
29 0.21
30 0.19
31 0.17
32 0.18
33 0.17
34 0.18
35 0.17
36 0.19
37 0.17
38 0.2
39 0.19
40 0.16
41 0.2
42 0.21
43 0.21
44 0.23
45 0.25
46 0.23
47 0.22
48 0.22
49 0.18
50 0.16
51 0.14
52 0.1
53 0.09
54 0.1
55 0.1
56 0.09
57 0.08
58 0.08
59 0.08
60 0.09
61 0.1
62 0.11
63 0.12
64 0.12
65 0.12
66 0.13
67 0.13
68 0.1
69 0.09
70 0.08
71 0.07
72 0.07
73 0.08
74 0.08
75 0.07
76 0.07
77 0.06
78 0.06
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.08
91 0.08
92 0.1
93 0.15
94 0.2
95 0.25
96 0.28
97 0.31
98 0.33
99 0.36
100 0.38
101 0.35
102 0.3
103 0.27
104 0.27
105 0.28
106 0.28
107 0.26
108 0.24
109 0.25
110 0.26
111 0.23
112 0.21
113 0.18
114 0.16
115 0.16
116 0.14
117 0.12
118 0.11
119 0.11
120 0.1
121 0.09
122 0.08
123 0.08
124 0.08
125 0.06
126 0.08
127 0.08
128 0.1
129 0.13
130 0.14
131 0.11
132 0.12
133 0.17
134 0.15
135 0.17
136 0.14
137 0.12
138 0.12
139 0.14
140 0.15
141 0.13
142 0.16
143 0.2
144 0.26
145 0.28
146 0.27
147 0.29
148 0.3
149 0.28
150 0.28
151 0.26
152 0.21
153 0.18
154 0.19
155 0.17
156 0.15
157 0.17
158 0.18
159 0.18
160 0.16
161 0.17
162 0.17
163 0.23
164 0.27
165 0.29
166 0.29
167 0.33
168 0.37
169 0.37
170 0.39
171 0.33
172 0.29
173 0.27
174 0.26
175 0.26
176 0.24
177 0.23
178 0.22
179 0.24
180 0.25
181 0.24
182 0.22
183 0.16
184 0.15
185 0.14
186 0.16
187 0.16
188 0.15
189 0.14
190 0.15
191 0.15
192 0.15
193 0.15
194 0.13
195 0.12
196 0.12
197 0.12
198 0.11
199 0.1
200 0.1
201 0.13
202 0.14
203 0.13
204 0.18
205 0.18
206 0.18
207 0.19
208 0.19
209 0.16
210 0.15
211 0.17
212 0.13
213 0.18
214 0.24
215 0.27
216 0.36
217 0.41
218 0.49
219 0.54
220 0.62
221 0.68
222 0.73
223 0.79