Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QL62

Protein Details
Accession S7QL62    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-34RPGTGQTRSKKARRKGKLSLIVDHydrophilic
NLS Segment(s)
PositionSequence
19-28RSKKARRKGK
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
KEGG gtr:GLOTRDRAFT_13676  -  
Pfam View protein in Pfam  
PF00646  F-box  
PROSITE View protein in PROSITE  
PS50181  FBOX  
CDD cd09917  F-box_SF  
Amino Acid Sequences SQKRRQLEADERPGTGQTRSKKARRKGKLSLIVDMPLDILLEIFQHLQPLDLLHMARTTKSLRGIIMHRSAKTIWTASFALRPNFPECPPEMSLPAWARFLCDPHC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.34
4 0.3
5 0.38
6 0.46
7 0.54
8 0.61
9 0.69
10 0.76
11 0.79
12 0.81
13 0.81
14 0.83
15 0.84
16 0.77
17 0.72
18 0.62
19 0.54
20 0.45
21 0.35
22 0.24
23 0.14
24 0.11
25 0.07
26 0.05
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.08
42 0.08
43 0.08
44 0.1
45 0.1
46 0.11
47 0.14
48 0.15
49 0.14
50 0.17
51 0.19
52 0.22
53 0.29
54 0.31
55 0.28
56 0.29
57 0.29
58 0.27
59 0.27
60 0.24
61 0.16
62 0.17
63 0.17
64 0.16
65 0.21
66 0.23
67 0.23
68 0.23
69 0.26
70 0.26
71 0.28
72 0.28
73 0.26
74 0.25
75 0.29
76 0.3
77 0.3
78 0.28
79 0.25
80 0.32
81 0.32
82 0.32
83 0.29
84 0.26
85 0.27
86 0.26