Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7S2U8

Protein Details
Accession S7S2U8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-22PWNATKAKRLRTLQEKKEAQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005061  Ist1  
IPR042277  IST1-like  
Gene Ontology GO:0015031  P:protein transport  
KEGG gtr:GLOTRDRAFT_101968  -  
Pfam View protein in Pfam  
PF03398  Ist1  
Amino Acid Sequences MPPWNATKAKRLRTLQEKKEAQAKATRRDIATLLERGKLETARIKVENIINEDIYLELLELLELYSELLIARFGLLEQNTPEPDPGVSEAVCSIIYAAPRTELKELHVLRDLLMHKYGREFSLGVMENRDNCVSDRVLRKINVGMPPPELVDAYLTEIAKGYGLKYSPRNDGGEGGVRESESDEVVEGEGEGVKTPPKLPELPLEEKDSKPAPAAEKQKPPEDDFEMLKKRFEALKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.8
4 0.76
5 0.7
6 0.73
7 0.65
8 0.58
9 0.56
10 0.54
11 0.52
12 0.55
13 0.56
14 0.49
15 0.5
16 0.47
17 0.44
18 0.42
19 0.39
20 0.33
21 0.32
22 0.31
23 0.3
24 0.31
25 0.26
26 0.24
27 0.25
28 0.25
29 0.28
30 0.29
31 0.29
32 0.31
33 0.34
34 0.34
35 0.32
36 0.32
37 0.26
38 0.25
39 0.24
40 0.19
41 0.15
42 0.11
43 0.07
44 0.04
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.06
62 0.07
63 0.08
64 0.1
65 0.12
66 0.13
67 0.13
68 0.13
69 0.11
70 0.11
71 0.11
72 0.11
73 0.1
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.07
80 0.06
81 0.06
82 0.06
83 0.07
84 0.07
85 0.08
86 0.09
87 0.11
88 0.12
89 0.11
90 0.13
91 0.2
92 0.21
93 0.21
94 0.23
95 0.22
96 0.2
97 0.25
98 0.24
99 0.17
100 0.19
101 0.17
102 0.14
103 0.16
104 0.17
105 0.12
106 0.12
107 0.11
108 0.08
109 0.14
110 0.15
111 0.14
112 0.15
113 0.15
114 0.15
115 0.16
116 0.16
117 0.11
118 0.1
119 0.12
120 0.11
121 0.16
122 0.19
123 0.21
124 0.25
125 0.25
126 0.25
127 0.26
128 0.29
129 0.29
130 0.27
131 0.25
132 0.22
133 0.22
134 0.21
135 0.19
136 0.15
137 0.1
138 0.09
139 0.08
140 0.09
141 0.1
142 0.1
143 0.09
144 0.09
145 0.09
146 0.09
147 0.09
148 0.07
149 0.07
150 0.08
151 0.12
152 0.18
153 0.21
154 0.26
155 0.29
156 0.3
157 0.28
158 0.29
159 0.28
160 0.29
161 0.26
162 0.23
163 0.2
164 0.18
165 0.17
166 0.16
167 0.14
168 0.08
169 0.08
170 0.07
171 0.07
172 0.07
173 0.07
174 0.05
175 0.05
176 0.06
177 0.06
178 0.06
179 0.06
180 0.08
181 0.09
182 0.1
183 0.13
184 0.16
185 0.18
186 0.2
187 0.28
188 0.35
189 0.4
190 0.42
191 0.47
192 0.46
193 0.45
194 0.48
195 0.41
196 0.34
197 0.3
198 0.31
199 0.28
200 0.33
201 0.42
202 0.45
203 0.53
204 0.56
205 0.62
206 0.63
207 0.61
208 0.59
209 0.56
210 0.51
211 0.46
212 0.51
213 0.51
214 0.48
215 0.47
216 0.41
217 0.39
218 0.42