Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RK93

Protein Details
Accession S7RK93    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
289-310DPYNNGGKRRKSKNSQHTQDSSHydrophilic
NLS Segment(s)
PositionSequence
295-299GKRRK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018608  Gti1/Pac2  
KEGG gtr:GLOTRDRAFT_63670  -  
Pfam View protein in Pfam  
PF09729  Gti1_Pac2  
Amino Acid Sequences MSGASNPAQPASTTAWTEPPWCGWIETTGDALLILEAARRGIIPRVTRRLVDSERKMITSGSVFVFDEEESGIKRWTDGFFWSPSRILGNFLLYRETDKRGAGHRGLRAEPSEYEGNGHNGQYGAQGMGPDLAPLSRPKGEPRTISLDKYRERTLLGSLTNSYKFKPDGLMKKTFSLTIGGVSQHLISYYRVSDVEQGRLRPPSSVPELAALDISPEYLDKTHFRNPPKVELGADGVIRYRGEADELDLAPRMFPSPSYGVPLLAEPRIPSPTSDTGSSGPGKRSKRYDPYNNGGKRRKSKNSQHTQDSSGDAEQEIQSPVASSPESPQSYIDQGITPVPHYVPYGAAPYGYYQGSGGYGTTSPPPMYGTAPYAPGQPVASPTATSPQAGSPTSPQGPSPPPPPYPSYASGGVETMMQPAPMQQHMYPYYPAPYTSYPPYSPPSAGSAAGPGNAWYMSYPPPTLPVGKAPGIPALATSSAHITPVEENDDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.29
4 0.31
5 0.29
6 0.26
7 0.24
8 0.22
9 0.22
10 0.18
11 0.2
12 0.22
13 0.21
14 0.2
15 0.18
16 0.17
17 0.15
18 0.14
19 0.11
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.09
28 0.14
29 0.2
30 0.27
31 0.36
32 0.44
33 0.47
34 0.48
35 0.51
36 0.54
37 0.56
38 0.58
39 0.56
40 0.55
41 0.55
42 0.54
43 0.51
44 0.43
45 0.37
46 0.29
47 0.25
48 0.18
49 0.18
50 0.17
51 0.17
52 0.18
53 0.14
54 0.13
55 0.1
56 0.1
57 0.1
58 0.11
59 0.12
60 0.11
61 0.12
62 0.14
63 0.15
64 0.16
65 0.18
66 0.2
67 0.24
68 0.27
69 0.28
70 0.26
71 0.26
72 0.27
73 0.23
74 0.23
75 0.2
76 0.23
77 0.23
78 0.23
79 0.24
80 0.21
81 0.26
82 0.25
83 0.28
84 0.24
85 0.24
86 0.27
87 0.3
88 0.37
89 0.37
90 0.4
91 0.41
92 0.43
93 0.43
94 0.43
95 0.39
96 0.35
97 0.3
98 0.29
99 0.26
100 0.21
101 0.21
102 0.2
103 0.23
104 0.21
105 0.21
106 0.16
107 0.14
108 0.14
109 0.14
110 0.13
111 0.09
112 0.08
113 0.08
114 0.07
115 0.08
116 0.07
117 0.06
118 0.06
119 0.06
120 0.06
121 0.08
122 0.12
123 0.14
124 0.15
125 0.21
126 0.29
127 0.34
128 0.35
129 0.39
130 0.44
131 0.43
132 0.46
133 0.47
134 0.46
135 0.45
136 0.47
137 0.45
138 0.36
139 0.35
140 0.32
141 0.29
142 0.26
143 0.22
144 0.2
145 0.19
146 0.21
147 0.24
148 0.23
149 0.21
150 0.2
151 0.19
152 0.19
153 0.22
154 0.27
155 0.33
156 0.38
157 0.44
158 0.43
159 0.45
160 0.45
161 0.4
162 0.33
163 0.26
164 0.2
165 0.14
166 0.14
167 0.11
168 0.11
169 0.11
170 0.1
171 0.08
172 0.08
173 0.08
174 0.07
175 0.08
176 0.08
177 0.09
178 0.09
179 0.1
180 0.16
181 0.17
182 0.23
183 0.24
184 0.25
185 0.26
186 0.28
187 0.28
188 0.23
189 0.22
190 0.2
191 0.22
192 0.22
193 0.2
194 0.2
195 0.2
196 0.19
197 0.18
198 0.13
199 0.09
200 0.07
201 0.07
202 0.04
203 0.04
204 0.04
205 0.05
206 0.07
207 0.08
208 0.12
209 0.2
210 0.26
211 0.29
212 0.37
213 0.39
214 0.44
215 0.45
216 0.42
217 0.34
218 0.3
219 0.29
220 0.22
221 0.2
222 0.13
223 0.1
224 0.1
225 0.09
226 0.08
227 0.06
228 0.05
229 0.06
230 0.06
231 0.07
232 0.09
233 0.09
234 0.09
235 0.09
236 0.09
237 0.08
238 0.08
239 0.08
240 0.05
241 0.05
242 0.08
243 0.1
244 0.11
245 0.14
246 0.14
247 0.14
248 0.14
249 0.15
250 0.13
251 0.11
252 0.11
253 0.08
254 0.09
255 0.11
256 0.11
257 0.1
258 0.14
259 0.17
260 0.18
261 0.18
262 0.19
263 0.18
264 0.21
265 0.23
266 0.2
267 0.2
268 0.25
269 0.28
270 0.3
271 0.35
272 0.4
273 0.46
274 0.53
275 0.6
276 0.61
277 0.66
278 0.71
279 0.71
280 0.73
281 0.71
282 0.7
283 0.69
284 0.7
285 0.72
286 0.72
287 0.77
288 0.79
289 0.82
290 0.82
291 0.81
292 0.75
293 0.7
294 0.62
295 0.53
296 0.44
297 0.33
298 0.26
299 0.18
300 0.16
301 0.12
302 0.12
303 0.1
304 0.08
305 0.08
306 0.08
307 0.08
308 0.08
309 0.08
310 0.07
311 0.09
312 0.16
313 0.17
314 0.17
315 0.18
316 0.19
317 0.2
318 0.21
319 0.19
320 0.13
321 0.13
322 0.14
323 0.13
324 0.12
325 0.11
326 0.1
327 0.1
328 0.11
329 0.1
330 0.09
331 0.1
332 0.12
333 0.11
334 0.11
335 0.1
336 0.11
337 0.13
338 0.12
339 0.11
340 0.08
341 0.08
342 0.09
343 0.09
344 0.07
345 0.06
346 0.07
347 0.08
348 0.09
349 0.1
350 0.1
351 0.1
352 0.12
353 0.12
354 0.13
355 0.14
356 0.16
357 0.16
358 0.19
359 0.19
360 0.2
361 0.19
362 0.18
363 0.17
364 0.13
365 0.14
366 0.14
367 0.14
368 0.13
369 0.13
370 0.17
371 0.17
372 0.17
373 0.16
374 0.15
375 0.18
376 0.18
377 0.19
378 0.18
379 0.23
380 0.25
381 0.25
382 0.23
383 0.25
384 0.3
385 0.33
386 0.35
387 0.35
388 0.36
389 0.39
390 0.42
391 0.41
392 0.42
393 0.41
394 0.4
395 0.37
396 0.36
397 0.32
398 0.29
399 0.24
400 0.19
401 0.16
402 0.15
403 0.11
404 0.1
405 0.09
406 0.11
407 0.14
408 0.15
409 0.18
410 0.16
411 0.23
412 0.26
413 0.29
414 0.28
415 0.27
416 0.29
417 0.26
418 0.26
419 0.24
420 0.24
421 0.26
422 0.31
423 0.34
424 0.32
425 0.35
426 0.38
427 0.37
428 0.35
429 0.32
430 0.31
431 0.28
432 0.27
433 0.24
434 0.23
435 0.2
436 0.2
437 0.18
438 0.14
439 0.13
440 0.12
441 0.12
442 0.09
443 0.11
444 0.14
445 0.17
446 0.18
447 0.17
448 0.2
449 0.23
450 0.26
451 0.25
452 0.28
453 0.3
454 0.31
455 0.33
456 0.31
457 0.31
458 0.29
459 0.27
460 0.21
461 0.19
462 0.17
463 0.16
464 0.16
465 0.16
466 0.16
467 0.17
468 0.16
469 0.14
470 0.16
471 0.19