Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RCL1

Protein Details
Accession S7RCL1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
68-99AFKKEDNKKNKWVKLKEKKQRKIDNKIYREFEBasic
NLS Segment(s)
PositionSequence
55-89KPPRKLSKVEKEMAFKKEDNKKNKWVKLKEKKQRK
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_97208  -  
Amino Acid Sequences MPPIRNTVTGLKGKGPPGVRPAPAVVPPPAPAPEPPVSGAPEGENPANAPGETEKPPRKLSKVEKEMAFKKEDNKKNKWVKLKEKKQRKIDNKIYREFELENGMEEGAAQSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.35
4 0.37
5 0.41
6 0.37
7 0.34
8 0.35
9 0.32
10 0.33
11 0.32
12 0.26
13 0.22
14 0.22
15 0.22
16 0.21
17 0.19
18 0.17
19 0.2
20 0.2
21 0.2
22 0.21
23 0.2
24 0.21
25 0.2
26 0.2
27 0.14
28 0.14
29 0.14
30 0.13
31 0.11
32 0.1
33 0.1
34 0.1
35 0.09
36 0.08
37 0.07
38 0.11
39 0.13
40 0.2
41 0.23
42 0.26
43 0.3
44 0.32
45 0.34
46 0.38
47 0.45
48 0.49
49 0.51
50 0.53
51 0.53
52 0.57
53 0.59
54 0.54
55 0.48
56 0.39
57 0.4
58 0.45
59 0.5
60 0.52
61 0.53
62 0.6
63 0.66
64 0.72
65 0.74
66 0.74
67 0.77
68 0.81
69 0.85
70 0.86
71 0.87
72 0.9
73 0.9
74 0.91
75 0.9
76 0.9
77 0.9
78 0.9
79 0.87
80 0.85
81 0.8
82 0.71
83 0.64
84 0.54
85 0.45
86 0.4
87 0.33
88 0.27
89 0.22
90 0.2
91 0.16
92 0.15
93 0.14