Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7Q1U4

Protein Details
Accession S7Q1U4    Localization Confidence High Confidence Score 19.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-50SQQARREKALEEQKRRRARKVDASRQLDLHydrophilic
100-133PAQPEPQQSGKKKPKKRKKRSAKKANKWADKCMYHydrophilic
NLS Segment(s)
PositionSequence
33-41EQKRRRARK
109-126GKKKPKKRKKRSAKKANK
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017336  Snurportin-1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0061015  P:snRNA import into nucleus  
KEGG gtr:GLOTRDRAFT_116937  -  
Amino Acid Sequences MFSERKASYKAPPSSVIDIRQSQQARREKALEEQKRRRARKVDASRQLDLFADLTLGPSDDEADENGDGEPEVVRSGVASFASLLPGPSSSTPTPSTNDPAQPEPQQSGKKKPKKRKKRSAKKANKWADKCMYAELLEMDEASPWSDGLPDDLETGFVAVAPVPVGKRCLAVTHQSAGYPVTGPNTTLRSRLQGKSLMPPFPSPLPPSTILDCILDSRWQENGILHVLDVIQWKGQEVGECETAFRFWWRDTRLSELPPFPPPPSAPLEPPASADPAHFPQTSTFPPSTQRYRFPHPATLLPIPYHPSTSVPALASHIIPAARSVRHVTVQIPSSPRFSYTSAMDIDMAFGSGSGGGSGGGSASGMKEVTYEIPPDGLLLYVAQASYEPGTSPLSSWVPLRPDPDSGVSEGALDVFERLVRRRLAGATAQGQLIEVDMDAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.53
4 0.5
5 0.48
6 0.45
7 0.48
8 0.46
9 0.44
10 0.49
11 0.53
12 0.52
13 0.54
14 0.56
15 0.5
16 0.56
17 0.62
18 0.64
19 0.66
20 0.7
21 0.75
22 0.81
23 0.85
24 0.84
25 0.82
26 0.81
27 0.81
28 0.82
29 0.83
30 0.83
31 0.84
32 0.79
33 0.7
34 0.62
35 0.51
36 0.41
37 0.3
38 0.2
39 0.14
40 0.1
41 0.1
42 0.09
43 0.09
44 0.07
45 0.07
46 0.08
47 0.08
48 0.08
49 0.08
50 0.1
51 0.1
52 0.1
53 0.1
54 0.09
55 0.08
56 0.08
57 0.08
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.08
69 0.1
70 0.09
71 0.09
72 0.08
73 0.09
74 0.1
75 0.1
76 0.15
77 0.15
78 0.18
79 0.21
80 0.23
81 0.25
82 0.27
83 0.31
84 0.3
85 0.34
86 0.34
87 0.34
88 0.36
89 0.37
90 0.37
91 0.34
92 0.36
93 0.4
94 0.42
95 0.49
96 0.56
97 0.62
98 0.7
99 0.78
100 0.83
101 0.86
102 0.93
103 0.93
104 0.94
105 0.95
106 0.97
107 0.97
108 0.97
109 0.96
110 0.96
111 0.95
112 0.94
113 0.86
114 0.83
115 0.77
116 0.68
117 0.59
118 0.5
119 0.41
120 0.31
121 0.28
122 0.2
123 0.14
124 0.11
125 0.1
126 0.08
127 0.06
128 0.06
129 0.06
130 0.06
131 0.05
132 0.05
133 0.06
134 0.05
135 0.06
136 0.07
137 0.07
138 0.08
139 0.08
140 0.08
141 0.07
142 0.08
143 0.06
144 0.05
145 0.05
146 0.04
147 0.04
148 0.04
149 0.05
150 0.05
151 0.06
152 0.08
153 0.08
154 0.09
155 0.09
156 0.11
157 0.13
158 0.18
159 0.2
160 0.21
161 0.21
162 0.19
163 0.2
164 0.18
165 0.16
166 0.12
167 0.09
168 0.09
169 0.09
170 0.09
171 0.11
172 0.14
173 0.15
174 0.17
175 0.17
176 0.2
177 0.26
178 0.26
179 0.27
180 0.28
181 0.29
182 0.35
183 0.38
184 0.35
185 0.31
186 0.3
187 0.29
188 0.26
189 0.27
190 0.21
191 0.18
192 0.19
193 0.2
194 0.21
195 0.2
196 0.19
197 0.18
198 0.16
199 0.15
200 0.12
201 0.11
202 0.11
203 0.1
204 0.1
205 0.09
206 0.09
207 0.1
208 0.09
209 0.1
210 0.1
211 0.09
212 0.08
213 0.07
214 0.07
215 0.08
216 0.08
217 0.07
218 0.06
219 0.06
220 0.07
221 0.07
222 0.08
223 0.08
224 0.09
225 0.11
226 0.13
227 0.13
228 0.13
229 0.12
230 0.12
231 0.11
232 0.1
233 0.09
234 0.09
235 0.14
236 0.17
237 0.22
238 0.23
239 0.3
240 0.31
241 0.33
242 0.35
243 0.32
244 0.31
245 0.31
246 0.31
247 0.25
248 0.24
249 0.21
250 0.21
251 0.24
252 0.24
253 0.22
254 0.24
255 0.26
256 0.24
257 0.25
258 0.22
259 0.18
260 0.16
261 0.15
262 0.15
263 0.15
264 0.18
265 0.17
266 0.16
267 0.17
268 0.2
269 0.21
270 0.23
271 0.21
272 0.18
273 0.24
274 0.29
275 0.35
276 0.36
277 0.42
278 0.43
279 0.51
280 0.58
281 0.57
282 0.58
283 0.53
284 0.52
285 0.49
286 0.47
287 0.41
288 0.33
289 0.3
290 0.27
291 0.25
292 0.23
293 0.18
294 0.16
295 0.16
296 0.17
297 0.18
298 0.15
299 0.15
300 0.16
301 0.16
302 0.15
303 0.13
304 0.12
305 0.1
306 0.1
307 0.11
308 0.13
309 0.12
310 0.14
311 0.17
312 0.17
313 0.19
314 0.21
315 0.2
316 0.22
317 0.24
318 0.27
319 0.28
320 0.27
321 0.29
322 0.28
323 0.28
324 0.26
325 0.26
326 0.24
327 0.22
328 0.24
329 0.21
330 0.22
331 0.2
332 0.17
333 0.16
334 0.13
335 0.11
336 0.07
337 0.06
338 0.05
339 0.05
340 0.05
341 0.04
342 0.04
343 0.04
344 0.04
345 0.04
346 0.03
347 0.03
348 0.03
349 0.03
350 0.04
351 0.05
352 0.05
353 0.05
354 0.05
355 0.07
356 0.1
357 0.11
358 0.12
359 0.12
360 0.12
361 0.12
362 0.12
363 0.11
364 0.08
365 0.07
366 0.06
367 0.06
368 0.06
369 0.06
370 0.06
371 0.06
372 0.07
373 0.08
374 0.08
375 0.08
376 0.09
377 0.12
378 0.12
379 0.13
380 0.16
381 0.17
382 0.18
383 0.19
384 0.23
385 0.25
386 0.28
387 0.31
388 0.28
389 0.3
390 0.32
391 0.34
392 0.32
393 0.28
394 0.27
395 0.23
396 0.21
397 0.18
398 0.15
399 0.11
400 0.09
401 0.07
402 0.06
403 0.08
404 0.11
405 0.14
406 0.2
407 0.22
408 0.24
409 0.27
410 0.29
411 0.31
412 0.33
413 0.37
414 0.35
415 0.36
416 0.34
417 0.3
418 0.28
419 0.23
420 0.19
421 0.12