Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7PR47

Protein Details
Accession S7PR47    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
90-116QASVSKKPRVRPPKKAAPRPAKAPKPPHydrophilic
NLS Segment(s)
PositionSequence
95-130KKPRVRPPKKAAPRPAKAPKPPGPKNAASQRSRGRK
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_134524  -  
Amino Acid Sequences MLDRTSVKQNKAIALSLHQSRAEGPDESKQAPKPGPSQKRRVEELDDDDSEEDVARPSKQIRIRKAGPLAAASQKRKQLPVEAEEEDEPQASVSKKPRVRPPKKAAPRPAKAPKPPGPKNAASQRSRGRKAVATASRVGCTNVSNCLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.34
4 0.34
5 0.29
6 0.27
7 0.25
8 0.27
9 0.25
10 0.21
11 0.2
12 0.23
13 0.27
14 0.28
15 0.32
16 0.31
17 0.34
18 0.34
19 0.36
20 0.38
21 0.45
22 0.53
23 0.56
24 0.64
25 0.67
26 0.71
27 0.71
28 0.67
29 0.61
30 0.56
31 0.54
32 0.5
33 0.41
34 0.36
35 0.32
36 0.28
37 0.22
38 0.17
39 0.11
40 0.07
41 0.08
42 0.07
43 0.08
44 0.09
45 0.16
46 0.23
47 0.3
48 0.35
49 0.42
50 0.44
51 0.49
52 0.51
53 0.46
54 0.4
55 0.34
56 0.3
57 0.29
58 0.31
59 0.28
60 0.29
61 0.31
62 0.32
63 0.32
64 0.31
65 0.3
66 0.29
67 0.29
68 0.3
69 0.26
70 0.26
71 0.25
72 0.25
73 0.19
74 0.16
75 0.12
76 0.08
77 0.09
78 0.08
79 0.12
80 0.17
81 0.25
82 0.29
83 0.35
84 0.45
85 0.55
86 0.63
87 0.7
88 0.74
89 0.77
90 0.83
91 0.87
92 0.87
93 0.86
94 0.83
95 0.82
96 0.83
97 0.81
98 0.77
99 0.77
100 0.76
101 0.76
102 0.77
103 0.75
104 0.72
105 0.66
106 0.68
107 0.69
108 0.69
109 0.61
110 0.63
111 0.64
112 0.67
113 0.69
114 0.63
115 0.58
116 0.53
117 0.55
118 0.58
119 0.54
120 0.48
121 0.5
122 0.49
123 0.46
124 0.42
125 0.38
126 0.29
127 0.26
128 0.23
129 0.25