Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RMU2

Protein Details
Accession S7RMU2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
175-196SLPSRAHKKKTHPRLSPMPREPBasic
NLS Segment(s)
PositionSequence
179-212RAHKKKTHPRLSPMPREPPVPPRLAQKRDRAGLR
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_139428  -  
Amino Acid Sequences MPRVPSVQVSVSPDEDIPSVSSAVDGSVNGDVVAGPTPDPELDDVMLIPGDAVGPTGTHLDDNVPPSSRATTSRPRRLPSLSNLVLHSPSSIVGTPLDPAARFEYPFPPSSEGSSPELENIYSPSLAYSPFLSPGPSRFHHVPVPAIPLLTPSFSTPVFTTNPPALSLPHFHLSSLPSRAHKKKTHPRLSPMPREPPVPPRLAQKRDRAGLRIQNGKGPDRTKEEEDLRSRSVDDGSSTSGDLTPSPQNGSSSDSLPGEYDDQLRRYSFPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.19
4 0.15
5 0.14
6 0.12
7 0.11
8 0.11
9 0.09
10 0.1
11 0.09
12 0.07
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.07
19 0.07
20 0.08
21 0.07
22 0.06
23 0.07
24 0.08
25 0.08
26 0.09
27 0.09
28 0.1
29 0.09
30 0.1
31 0.09
32 0.09
33 0.09
34 0.07
35 0.06
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.06
44 0.07
45 0.06
46 0.07
47 0.09
48 0.12
49 0.15
50 0.16
51 0.17
52 0.17
53 0.18
54 0.2
55 0.19
56 0.21
57 0.24
58 0.32
59 0.41
60 0.51
61 0.55
62 0.56
63 0.59
64 0.6
65 0.59
66 0.55
67 0.55
68 0.48
69 0.44
70 0.42
71 0.39
72 0.34
73 0.29
74 0.23
75 0.13
76 0.1
77 0.1
78 0.09
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.07
86 0.09
87 0.12
88 0.12
89 0.12
90 0.14
91 0.17
92 0.19
93 0.21
94 0.21
95 0.21
96 0.2
97 0.23
98 0.23
99 0.22
100 0.22
101 0.21
102 0.19
103 0.17
104 0.17
105 0.14
106 0.12
107 0.1
108 0.08
109 0.07
110 0.07
111 0.06
112 0.06
113 0.06
114 0.07
115 0.07
116 0.06
117 0.08
118 0.08
119 0.09
120 0.09
121 0.12
122 0.16
123 0.15
124 0.2
125 0.2
126 0.22
127 0.24
128 0.25
129 0.23
130 0.2
131 0.23
132 0.19
133 0.17
134 0.14
135 0.14
136 0.13
137 0.12
138 0.11
139 0.07
140 0.09
141 0.09
142 0.1
143 0.09
144 0.11
145 0.13
146 0.13
147 0.15
148 0.15
149 0.16
150 0.15
151 0.16
152 0.14
153 0.14
154 0.16
155 0.16
156 0.18
157 0.18
158 0.17
159 0.18
160 0.18
161 0.21
162 0.22
163 0.21
164 0.22
165 0.3
166 0.37
167 0.44
168 0.49
169 0.55
170 0.62
171 0.71
172 0.77
173 0.76
174 0.77
175 0.8
176 0.83
177 0.83
178 0.79
179 0.76
180 0.68
181 0.64
182 0.59
183 0.57
184 0.52
185 0.45
186 0.4
187 0.41
188 0.49
189 0.54
190 0.58
191 0.59
192 0.61
193 0.64
194 0.66
195 0.59
196 0.57
197 0.57
198 0.57
199 0.56
200 0.49
201 0.47
202 0.47
203 0.48
204 0.47
205 0.42
206 0.4
207 0.39
208 0.43
209 0.43
210 0.46
211 0.47
212 0.5
213 0.53
214 0.53
215 0.47
216 0.43
217 0.4
218 0.34
219 0.31
220 0.23
221 0.2
222 0.17
223 0.18
224 0.18
225 0.17
226 0.17
227 0.16
228 0.15
229 0.13
230 0.15
231 0.16
232 0.17
233 0.2
234 0.21
235 0.21
236 0.22
237 0.27
238 0.26
239 0.23
240 0.24
241 0.22
242 0.21
243 0.2
244 0.21
245 0.18
246 0.18
247 0.22
248 0.24
249 0.25
250 0.28
251 0.28