Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QCQ3

Protein Details
Accession S7QCQ3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-79PVISPRTRKFLKPKPRRMRFPAFPKPPDHydrophilic
255-279SSASARAPKRRTKSLEKLKPLFLKSHydrophilic
NLS Segment(s)
PositionSequence
57-73RTRKFLKPKPRRMRFPA
243-271RGHRARAKTVSASSASARAPKRRTKSLEK
Subcellular Location(s) extr 14, mito 5, plas 5, nucl 1, cyto 1, cyto_nucl 1, golg 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG gtr:GLOTRDRAFT_128013  -  
Amino Acid Sequences MSSGVSSRARTSAIRCLSIVIGVSGFLLSLLSVIISHCLPSSTPPGRLDNTPVISPRTRKFLKPKPRRMRFPAFPKPPDHIPIPQHHRSSPFSQTVPASRSLHHASRSLSSLPCQGGLSRNPLAPADPPAVPSHRPSKSVSHSPLQHYTPRLPSLDEEPLHKPLPDLPSSLSSGSTNSARIDAQTQRIYPPASAAIASAGTHRVPLPPVKPAEMLVHRRPRTFSSPTVPPLPPLPLPPTLPPRGHRARAKTVSASSASARAPKRRTKSLEKLKPLFLKSFASLSDLKARDVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.34
4 0.32
5 0.3
6 0.26
7 0.17
8 0.12
9 0.1
10 0.1
11 0.08
12 0.07
13 0.05
14 0.05
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.06
22 0.06
23 0.07
24 0.07
25 0.08
26 0.08
27 0.11
28 0.2
29 0.22
30 0.27
31 0.3
32 0.34
33 0.36
34 0.38
35 0.41
36 0.39
37 0.38
38 0.35
39 0.34
40 0.34
41 0.36
42 0.4
43 0.37
44 0.39
45 0.39
46 0.45
47 0.53
48 0.59
49 0.65
50 0.71
51 0.8
52 0.82
53 0.89
54 0.91
55 0.89
56 0.89
57 0.87
58 0.86
59 0.86
60 0.84
61 0.78
62 0.72
63 0.68
64 0.62
65 0.56
66 0.49
67 0.44
68 0.4
69 0.45
70 0.5
71 0.52
72 0.51
73 0.49
74 0.5
75 0.48
76 0.47
77 0.44
78 0.4
79 0.34
80 0.34
81 0.34
82 0.33
83 0.31
84 0.32
85 0.27
86 0.23
87 0.28
88 0.3
89 0.31
90 0.29
91 0.3
92 0.26
93 0.27
94 0.29
95 0.26
96 0.22
97 0.2
98 0.21
99 0.18
100 0.18
101 0.16
102 0.14
103 0.16
104 0.17
105 0.21
106 0.19
107 0.19
108 0.19
109 0.19
110 0.18
111 0.16
112 0.17
113 0.14
114 0.12
115 0.13
116 0.14
117 0.16
118 0.16
119 0.18
120 0.24
121 0.23
122 0.25
123 0.26
124 0.31
125 0.35
126 0.41
127 0.42
128 0.39
129 0.41
130 0.42
131 0.44
132 0.4
133 0.37
134 0.32
135 0.32
136 0.29
137 0.27
138 0.24
139 0.21
140 0.19
141 0.2
142 0.23
143 0.21
144 0.21
145 0.22
146 0.25
147 0.24
148 0.23
149 0.19
150 0.18
151 0.22
152 0.19
153 0.18
154 0.16
155 0.18
156 0.2
157 0.2
158 0.17
159 0.13
160 0.12
161 0.13
162 0.12
163 0.11
164 0.1
165 0.11
166 0.1
167 0.1
168 0.14
169 0.15
170 0.19
171 0.21
172 0.21
173 0.21
174 0.23
175 0.24
176 0.2
177 0.18
178 0.14
179 0.12
180 0.11
181 0.1
182 0.08
183 0.08
184 0.08
185 0.07
186 0.08
187 0.07
188 0.08
189 0.08
190 0.09
191 0.11
192 0.15
193 0.16
194 0.21
195 0.22
196 0.24
197 0.24
198 0.25
199 0.29
200 0.32
201 0.37
202 0.4
203 0.49
204 0.49
205 0.5
206 0.52
207 0.51
208 0.5
209 0.48
210 0.45
211 0.41
212 0.45
213 0.47
214 0.5
215 0.45
216 0.4
217 0.37
218 0.35
219 0.3
220 0.27
221 0.27
222 0.25
223 0.27
224 0.31
225 0.36
226 0.39
227 0.42
228 0.41
229 0.46
230 0.51
231 0.57
232 0.58
233 0.59
234 0.63
235 0.66
236 0.68
237 0.64
238 0.58
239 0.54
240 0.48
241 0.42
242 0.33
243 0.31
244 0.27
245 0.3
246 0.33
247 0.37
248 0.42
249 0.5
250 0.56
251 0.62
252 0.68
253 0.72
254 0.78
255 0.81
256 0.84
257 0.85
258 0.82
259 0.81
260 0.81
261 0.75
262 0.67
263 0.59
264 0.53
265 0.45
266 0.42
267 0.34
268 0.31
269 0.28
270 0.28
271 0.34
272 0.3