Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RTQ7

Protein Details
Accession S7RTQ7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-34ENNAFRYVESPRRKRKGKNTRAPQAPGRLHydrophilic
NLS Segment(s)
PositionSequence
16-27PRRKRKGKNTRA
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
KEGG gtr:GLOTRDRAFT_119946  -  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MSAGNENNAFRYVESPRRKRKGKNTRAPQAPGRLLQRCLRELKDGQWLHESLDLVRDSLSELGWEGSIPVLCLGLGSPTASENAAAQLALLLGLCDELNVDITLLKGLEIQCLTENLVNASAPFPHFHSLKLVQNGRYEMDSQTLVFMPHCDVQLYEAILGQNWTIGKLPNMLFICNKFSEYETTKFQRKYPHLFRYRAAWAQPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.5
3 0.59
4 0.68
5 0.76
6 0.82
7 0.86
8 0.88
9 0.89
10 0.9
11 0.9
12 0.9
13 0.9
14 0.86
15 0.82
16 0.79
17 0.73
18 0.67
19 0.64
20 0.58
21 0.54
22 0.53
23 0.51
24 0.46
25 0.47
26 0.43
27 0.42
28 0.4
29 0.39
30 0.44
31 0.4
32 0.38
33 0.37
34 0.35
35 0.3
36 0.3
37 0.27
38 0.17
39 0.21
40 0.19
41 0.14
42 0.14
43 0.13
44 0.11
45 0.11
46 0.1
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.03
78 0.02
79 0.02
80 0.03
81 0.03
82 0.02
83 0.02
84 0.03
85 0.03
86 0.04
87 0.04
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.07
96 0.07
97 0.07
98 0.08
99 0.08
100 0.09
101 0.08
102 0.08
103 0.07
104 0.08
105 0.07
106 0.07
107 0.07
108 0.07
109 0.06
110 0.07
111 0.08
112 0.11
113 0.12
114 0.12
115 0.17
116 0.2
117 0.25
118 0.31
119 0.33
120 0.32
121 0.34
122 0.35
123 0.31
124 0.29
125 0.25
126 0.19
127 0.17
128 0.15
129 0.12
130 0.12
131 0.12
132 0.11
133 0.1
134 0.1
135 0.1
136 0.11
137 0.12
138 0.11
139 0.1
140 0.11
141 0.14
142 0.13
143 0.11
144 0.11
145 0.1
146 0.1
147 0.11
148 0.09
149 0.09
150 0.08
151 0.09
152 0.08
153 0.1
154 0.1
155 0.15
156 0.16
157 0.21
158 0.22
159 0.23
160 0.25
161 0.26
162 0.3
163 0.26
164 0.26
165 0.2
166 0.21
167 0.26
168 0.29
169 0.31
170 0.34
171 0.39
172 0.46
173 0.47
174 0.49
175 0.53
176 0.55
177 0.62
178 0.64
179 0.69
180 0.7
181 0.72
182 0.7
183 0.67
184 0.67
185 0.62
186 0.55