Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q7G2

Protein Details
Accession S7Q7G2    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
276-305LDESWKRPTPHNERRRAGKHTKRVVRAEMSHydrophilic
NLS Segment(s)
PositionSequence
286-298HNERRRAGKHTKR
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_138661  -  
Amino Acid Sequences MGSFHLRPVSDSSPSASPSPPRDHSSPSGKSSTTLPSQPSSTTSTIQSINGPRRPLSPSSLRDVDLSSNAVMTPRPYPPPPTGHELMSLFPPPPPPFMETTSGYFQRQERAFFAQKGKEILRVRIEVDLDRDIAMAVDREPEGKGKERERERERFGQQQQQQQVQLHPPRDARPWPAAQQPQQPQPPPQFSHPHPHHRQSPPAAVAPYPPPPHHLSRASPRVSAVPTTPSFTNVPPHAPRPYVQEVAVLPVHSQRAPMQVQVPHQHEPGQLEELPLDESWKRPTPHNERRRAGKHTKRVVRAEMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.29
4 0.31
5 0.34
6 0.41
7 0.42
8 0.45
9 0.46
10 0.5
11 0.55
12 0.58
13 0.57
14 0.55
15 0.54
16 0.48
17 0.46
18 0.42
19 0.41
20 0.37
21 0.35
22 0.33
23 0.31
24 0.33
25 0.33
26 0.33
27 0.32
28 0.3
29 0.28
30 0.26
31 0.26
32 0.26
33 0.26
34 0.29
35 0.31
36 0.37
37 0.39
38 0.4
39 0.38
40 0.39
41 0.43
42 0.4
43 0.39
44 0.39
45 0.38
46 0.43
47 0.45
48 0.42
49 0.39
50 0.37
51 0.33
52 0.25
53 0.24
54 0.16
55 0.14
56 0.13
57 0.12
58 0.11
59 0.11
60 0.12
61 0.14
62 0.18
63 0.2
64 0.25
65 0.29
66 0.34
67 0.36
68 0.4
69 0.39
70 0.35
71 0.37
72 0.33
73 0.29
74 0.26
75 0.23
76 0.16
77 0.15
78 0.19
79 0.16
80 0.18
81 0.19
82 0.19
83 0.21
84 0.24
85 0.28
86 0.25
87 0.28
88 0.3
89 0.3
90 0.28
91 0.27
92 0.25
93 0.28
94 0.28
95 0.26
96 0.24
97 0.29
98 0.32
99 0.33
100 0.37
101 0.33
102 0.33
103 0.35
104 0.33
105 0.34
106 0.32
107 0.33
108 0.31
109 0.3
110 0.29
111 0.27
112 0.27
113 0.2
114 0.21
115 0.17
116 0.14
117 0.13
118 0.12
119 0.09
120 0.08
121 0.08
122 0.05
123 0.04
124 0.05
125 0.05
126 0.06
127 0.06
128 0.08
129 0.1
130 0.15
131 0.2
132 0.23
133 0.31
134 0.36
135 0.45
136 0.5
137 0.54
138 0.54
139 0.58
140 0.57
141 0.58
142 0.56
143 0.56
144 0.54
145 0.54
146 0.53
147 0.47
148 0.46
149 0.39
150 0.38
151 0.36
152 0.36
153 0.31
154 0.3
155 0.29
156 0.29
157 0.32
158 0.32
159 0.29
160 0.29
161 0.3
162 0.3
163 0.35
164 0.38
165 0.38
166 0.44
167 0.45
168 0.47
169 0.5
170 0.49
171 0.47
172 0.47
173 0.49
174 0.44
175 0.44
176 0.43
177 0.41
178 0.49
179 0.51
180 0.55
181 0.56
182 0.59
183 0.63
184 0.61
185 0.65
186 0.59
187 0.59
188 0.51
189 0.48
190 0.42
191 0.33
192 0.31
193 0.27
194 0.29
195 0.26
196 0.24
197 0.25
198 0.28
199 0.32
200 0.36
201 0.37
202 0.37
203 0.43
204 0.52
205 0.5
206 0.46
207 0.43
208 0.4
209 0.37
210 0.33
211 0.25
212 0.23
213 0.22
214 0.24
215 0.23
216 0.23
217 0.23
218 0.22
219 0.27
220 0.23
221 0.29
222 0.29
223 0.33
224 0.34
225 0.34
226 0.34
227 0.36
228 0.4
229 0.36
230 0.32
231 0.31
232 0.28
233 0.3
234 0.3
235 0.22
236 0.16
237 0.17
238 0.19
239 0.16
240 0.17
241 0.15
242 0.2
243 0.22
244 0.24
245 0.26
246 0.28
247 0.34
248 0.41
249 0.44
250 0.41
251 0.4
252 0.41
253 0.38
254 0.37
255 0.34
256 0.3
257 0.26
258 0.23
259 0.22
260 0.19
261 0.19
262 0.16
263 0.16
264 0.13
265 0.15
266 0.2
267 0.28
268 0.29
269 0.34
270 0.45
271 0.53
272 0.63
273 0.71
274 0.75
275 0.76
276 0.85
277 0.85
278 0.84
279 0.84
280 0.84
281 0.84
282 0.84
283 0.86
284 0.85
285 0.84