Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q226

Protein Details
Accession S7Q226    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20TKKRRNNGRNKKGRGHVGFMBasic
83-113VRVRSREGRRNRAPPPRVRWKDGKKVNPAVVHydrophilic
NLS Segment(s)
PositionSequence
2-14KKRRNNGRNKKGR
86-107RSREGRRNRAPPPRVRWKDGKK
Subcellular Location(s) mito 13.5, mito_nucl 11.5, nucl 8.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG gtr:GLOTRDRAFT_14700  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences TKKRRNNGRNKKGRGHVGFMRCSNCSRAVPKDKAIKRFTVRNMVESAAVRDISDASVYPEYVVPKLYLKIAYCVSCAIHSHVVRVRSREGRRNRAPPPRVRWKDGKKVNPAVVAAEEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.76
3 0.73
4 0.69
5 0.67
6 0.61
7 0.56
8 0.47
9 0.44
10 0.41
11 0.37
12 0.34
13 0.33
14 0.38
15 0.44
16 0.46
17 0.51
18 0.58
19 0.59
20 0.64
21 0.62
22 0.6
23 0.56
24 0.59
25 0.56
26 0.57
27 0.52
28 0.46
29 0.44
30 0.37
31 0.34
32 0.27
33 0.24
34 0.15
35 0.14
36 0.11
37 0.1
38 0.09
39 0.08
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.09
53 0.1
54 0.11
55 0.11
56 0.13
57 0.15
58 0.15
59 0.14
60 0.14
61 0.14
62 0.13
63 0.13
64 0.14
65 0.19
66 0.18
67 0.21
68 0.24
69 0.29
70 0.3
71 0.32
72 0.35
73 0.37
74 0.44
75 0.49
76 0.56
77 0.61
78 0.68
79 0.73
80 0.76
81 0.78
82 0.8
83 0.8
84 0.8
85 0.81
86 0.79
87 0.77
88 0.79
89 0.78
90 0.8
91 0.81
92 0.8
93 0.79
94 0.81
95 0.79
96 0.72
97 0.63
98 0.55
99 0.46