Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RMB5

Protein Details
Accession S7RMB5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-23SATRRRTSGSRRRARGLRRGACHydrophilic
NLS Segment(s)
PositionSequence
6-19RRTSGSRRRARGLR
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR029052  Metallo-depent_PP-like  
IPR000979  Phosphodiesterase_MJ0936/Vps29  
Gene Ontology GO:0110165  C:cellular anatomical entity  
KEGG gtr:GLOTRDRAFT_100747  -  
Amino Acid Sequences MSATRRRTSGSRRRARGLRRGACCSPRWQLRLSAALPLSITVNHSPIKIDVVHGHQCIPTGDLDSLGATARQMDVESIFQAVEYDNHFFVNPGSATGAWTGACPVVVTYVYQLIDGEVRVETFKEAPRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.8
5 0.78
6 0.74
7 0.75
8 0.73
9 0.7
10 0.65
11 0.61
12 0.59
13 0.57
14 0.53
15 0.48
16 0.46
17 0.45
18 0.48
19 0.42
20 0.38
21 0.31
22 0.28
23 0.26
24 0.21
25 0.18
26 0.12
27 0.14
28 0.09
29 0.11
30 0.12
31 0.12
32 0.12
33 0.12
34 0.14
35 0.11
36 0.12
37 0.12
38 0.16
39 0.2
40 0.2
41 0.2
42 0.18
43 0.19
44 0.17
45 0.16
46 0.11
47 0.09
48 0.08
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.05
55 0.03
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.05
67 0.06
68 0.06
69 0.06
70 0.07
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.12
78 0.1
79 0.09
80 0.1
81 0.1
82 0.1
83 0.11
84 0.11
85 0.08
86 0.08
87 0.08
88 0.07
89 0.07
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.08
96 0.11
97 0.11
98 0.11
99 0.11
100 0.1
101 0.11
102 0.11
103 0.11
104 0.08
105 0.08
106 0.09
107 0.09
108 0.11
109 0.14
110 0.19