Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7PQB0

Protein Details
Accession S7PQB0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
25-44AADHKQDKGKQPERRPIRTTBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG gtr:GLOTRDRAFT_18577  -  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
CDD cd00303  retropepsin_like  
Amino Acid Sequences LSTSEREKYMKEGRCFTCGQTGHRAADHKQDKGKQPERRPIRTTEVKEDPYKGTSSTVDQSMKINILLSRGKGSAETTAEALIDSGAGGIFINQKFGLTNKLKTVPIPRPIKVFNVDRTKNRQGHITKAAFLQMKIGDRVRSVQFRVTDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.5
4 0.49
5 0.43
6 0.42
7 0.42
8 0.43
9 0.41
10 0.42
11 0.43
12 0.36
13 0.44
14 0.45
15 0.41
16 0.44
17 0.48
18 0.54
19 0.62
20 0.69
21 0.68
22 0.71
23 0.76
24 0.79
25 0.8
26 0.75
27 0.7
28 0.69
29 0.69
30 0.65
31 0.63
32 0.61
33 0.57
34 0.55
35 0.52
36 0.45
37 0.38
38 0.34
39 0.26
40 0.21
41 0.18
42 0.18
43 0.17
44 0.19
45 0.18
46 0.18
47 0.18
48 0.17
49 0.17
50 0.14
51 0.13
52 0.09
53 0.12
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.11
60 0.12
61 0.11
62 0.11
63 0.1
64 0.09
65 0.09
66 0.09
67 0.08
68 0.07
69 0.05
70 0.04
71 0.03
72 0.03
73 0.02
74 0.02
75 0.02
76 0.03
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.1
84 0.18
85 0.18
86 0.2
87 0.23
88 0.27
89 0.27
90 0.29
91 0.36
92 0.35
93 0.41
94 0.45
95 0.42
96 0.44
97 0.45
98 0.47
99 0.45
100 0.43
101 0.43
102 0.47
103 0.51
104 0.52
105 0.59
106 0.64
107 0.63
108 0.59
109 0.59
110 0.52
111 0.55
112 0.58
113 0.52
114 0.45
115 0.42
116 0.46
117 0.39
118 0.36
119 0.32
120 0.26
121 0.27
122 0.29
123 0.31
124 0.27
125 0.26
126 0.32
127 0.34
128 0.36
129 0.36
130 0.38