Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7PY33

Protein Details
Accession S7PY33    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
85-114HFMGPVRKPIPRPKPKPKPDGKPKRGGHAEBasic
NLS Segment(s)
PositionSequence
88-113GPVRKPIPRPKPKPKPDGKPKRGGHA
Subcellular Location(s) cyto 10, cyto_nucl 9.5, mito 9, nucl 7
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_122886  -  
Amino Acid Sequences MMSQDAIKGDYLQYRSSAILSMLSQSIGILLDSGAAQLTVGGHSGLQSGKDDNRLDVDEIEADSTSGGPPEKAAGYQSAVRPKIHFMGPVRKPIPRPKPKPKPDGKPKRGGHAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.18
5 0.13
6 0.12
7 0.11
8 0.12
9 0.11
10 0.1
11 0.09
12 0.08
13 0.08
14 0.06
15 0.06
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.04
26 0.03
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.06
34 0.06
35 0.08
36 0.09
37 0.14
38 0.14
39 0.13
40 0.15
41 0.15
42 0.15
43 0.13
44 0.13
45 0.08
46 0.08
47 0.08
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.04
56 0.04
57 0.06
58 0.06
59 0.06
60 0.07
61 0.08
62 0.1
63 0.13
64 0.17
65 0.23
66 0.25
67 0.26
68 0.26
69 0.28
70 0.29
71 0.27
72 0.29
73 0.26
74 0.35
75 0.38
76 0.46
77 0.46
78 0.46
79 0.51
80 0.56
81 0.62
82 0.63
83 0.7
84 0.71
85 0.81
86 0.86
87 0.92
88 0.91
89 0.91
90 0.92
91 0.93
92 0.91
93 0.9
94 0.84