Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RIS6

Protein Details
Accession S7RIS6    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-39NAKTTRPRKEKAEKADKPKRAPBasic
84-117QEPKPRAAPKPKAEKEKKTRAPRKAKKPAASSETBasic
NLS Segment(s)
PositionSequence
20-38KTTRPRKEKAEKADKPKRA
83-111GQEPKPRAAPKPKAEKEKKTRAPRKAKKP
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG gtr:GLOTRDRAFT_107384  -  
Pfam View protein in Pfam  
PF04690  YABBY  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAKTATETTTKTATKSANAKTTRPRKEKAEKADKPKRAPTAYNLFMKENLQKYRSEHDGMSVKEAMAEVAKLWRDAPENPNRGQEPKPRAAPKPKAEKEKKTRAPRKAKKPAASSETEEQEEHEEHEADAGDSDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.42
4 0.44
5 0.47
6 0.51
7 0.56
8 0.64
9 0.68
10 0.67
11 0.66
12 0.67
13 0.74
14 0.78
15 0.78
16 0.79
17 0.77
18 0.81
19 0.86
20 0.84
21 0.79
22 0.77
23 0.74
24 0.67
25 0.62
26 0.58
27 0.57
28 0.54
29 0.53
30 0.48
31 0.41
32 0.38
33 0.37
34 0.36
35 0.33
36 0.31
37 0.27
38 0.27
39 0.29
40 0.33
41 0.34
42 0.31
43 0.25
44 0.26
45 0.3
46 0.28
47 0.28
48 0.24
49 0.19
50 0.17
51 0.17
52 0.12
53 0.07
54 0.07
55 0.04
56 0.06
57 0.06
58 0.06
59 0.06
60 0.08
61 0.1
62 0.13
63 0.2
64 0.26
65 0.3
66 0.31
67 0.35
68 0.35
69 0.37
70 0.39
71 0.4
72 0.39
73 0.41
74 0.48
75 0.48
76 0.54
77 0.61
78 0.65
79 0.66
80 0.7
81 0.7
82 0.74
83 0.77
84 0.81
85 0.81
86 0.83
87 0.84
88 0.84
89 0.87
90 0.86
91 0.9
92 0.89
93 0.91
94 0.91
95 0.9
96 0.87
97 0.85
98 0.83
99 0.78
100 0.72
101 0.67
102 0.62
103 0.57
104 0.5
105 0.43
106 0.36
107 0.34
108 0.29
109 0.26
110 0.22
111 0.18
112 0.16
113 0.18
114 0.17
115 0.13