Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7QLH4

Protein Details
Accession S7QLH4    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-61VSSSRGAKRRWRHVQRPDGEHBasic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto_nucl 8.5, nucl 8, cyto 7
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_108852  -  
Amino Acid Sequences MTGQAANVALNEASRGPLSGPNMSRLIDVDETARTVPILVVSSSRGAKRRWRHVQRPDGEHSKYQGPAIHGHCQLAIGTESARTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.12
5 0.15
6 0.2
7 0.21
8 0.24
9 0.25
10 0.25
11 0.24
12 0.21
13 0.21
14 0.16
15 0.15
16 0.12
17 0.11
18 0.12
19 0.12
20 0.11
21 0.07
22 0.07
23 0.06
24 0.06
25 0.06
26 0.05
27 0.06
28 0.07
29 0.09
30 0.1
31 0.12
32 0.15
33 0.16
34 0.25
35 0.32
36 0.42
37 0.51
38 0.6
39 0.68
40 0.75
41 0.83
42 0.81
43 0.8
44 0.76
45 0.73
46 0.66
47 0.58
48 0.51
49 0.45
50 0.39
51 0.34
52 0.3
53 0.25
54 0.29
55 0.31
56 0.35
57 0.32
58 0.32
59 0.3
60 0.28
61 0.26
62 0.21
63 0.17
64 0.11
65 0.1