Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7Q929

Protein Details
Accession S7Q929    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-31RAEDSEAKSRKKKAKRDEEEDSAGBasic
NLS Segment(s)
PositionSequence
4-23KGKRRAEDSEAKSRKKKAKR
84-125KPRKSKTKGKEGTAKGKSASSSSTSNKAAPPSKSAKPASKRR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
KEGG gtr:GLOTRDRAFT_111072  -  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSTKGKRRAEDSEAKSRKKKAKRDEEEDSAGSDEDGGVEEDELDALDTSNIITSGRRTRGIRIDYTKVPDAIKSDEEDEDEEEKPRKSKTKGKEGTAKGKSASSSSTSNKAAPPSKSAKPASKRRIQEESEEELQDNNDEEEEEEEEGGDGTEEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.74
4 0.76
5 0.75
6 0.78
7 0.78
8 0.81
9 0.83
10 0.85
11 0.84
12 0.81
13 0.77
14 0.67
15 0.58
16 0.47
17 0.37
18 0.28
19 0.2
20 0.12
21 0.07
22 0.07
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.08
41 0.14
42 0.17
43 0.22
44 0.23
45 0.27
46 0.35
47 0.38
48 0.4
49 0.39
50 0.41
51 0.39
52 0.43
53 0.39
54 0.33
55 0.3
56 0.25
57 0.22
58 0.19
59 0.17
60 0.14
61 0.14
62 0.13
63 0.13
64 0.13
65 0.13
66 0.12
67 0.12
68 0.13
69 0.13
70 0.14
71 0.15
72 0.17
73 0.21
74 0.25
75 0.33
76 0.39
77 0.49
78 0.54
79 0.59
80 0.66
81 0.65
82 0.7
83 0.65
84 0.58
85 0.48
86 0.43
87 0.37
88 0.29
89 0.25
90 0.18
91 0.2
92 0.21
93 0.25
94 0.25
95 0.26
96 0.27
97 0.31
98 0.33
99 0.3
100 0.34
101 0.35
102 0.37
103 0.43
104 0.46
105 0.49
106 0.54
107 0.63
108 0.66
109 0.69
110 0.7
111 0.7
112 0.73
113 0.67
114 0.66
115 0.61
116 0.59
117 0.54
118 0.49
119 0.42
120 0.34
121 0.32
122 0.25
123 0.2
124 0.13
125 0.1
126 0.09
127 0.09
128 0.1
129 0.11
130 0.11
131 0.1
132 0.1
133 0.09
134 0.09
135 0.08
136 0.07
137 0.05