Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7PRU4

Protein Details
Accession S7PRU4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
198-230PQASVSKKPRVRPPKKAAPRPAKAPKPPGPKNAHydrophilic
NLS Segment(s)
PositionSequence
204-239KKPRVRPPKKAAPRPAKAPKPPGPKNAASQRSRGRK
Subcellular Location(s) nucl 17.5, mito_nucl 10, cyto 7
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_134258  -  
Amino Acid Sequences CYYTKGGKKIAGAEQLPRLYDNIENIFAIRKDFLETILKTLEIIGNAPLTVCLRRLGDLVLSHYRPDRSRYAQHELDLLTHDRVVFTIQEALDSEGWPDEANDGPRVFKMLDRTSVKQNKAIALSLHQSRAEGPDESKQAPKPGPSQKRRVEELDDDDSEEDVARPSKQIRIRKAGPLAAASQKRKQLPLEAEEEDEPQASVSKKPRVRPPKKAAPRPAKAPKPPGPKNAASQRSRGRKAVATASRVGCTNVSNCLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.43
4 0.37
5 0.31
6 0.25
7 0.25
8 0.25
9 0.22
10 0.21
11 0.2
12 0.2
13 0.23
14 0.21
15 0.21
16 0.17
17 0.14
18 0.16
19 0.17
20 0.19
21 0.22
22 0.23
23 0.24
24 0.24
25 0.23
26 0.2
27 0.2
28 0.19
29 0.12
30 0.12
31 0.1
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.1
38 0.1
39 0.12
40 0.12
41 0.13
42 0.14
43 0.14
44 0.15
45 0.16
46 0.2
47 0.24
48 0.23
49 0.24
50 0.26
51 0.28
52 0.27
53 0.31
54 0.32
55 0.32
56 0.4
57 0.45
58 0.5
59 0.49
60 0.48
61 0.46
62 0.4
63 0.34
64 0.29
65 0.24
66 0.17
67 0.15
68 0.14
69 0.11
70 0.11
71 0.11
72 0.08
73 0.07
74 0.1
75 0.09
76 0.1
77 0.1
78 0.12
79 0.12
80 0.11
81 0.11
82 0.07
83 0.08
84 0.07
85 0.07
86 0.06
87 0.07
88 0.09
89 0.11
90 0.11
91 0.11
92 0.11
93 0.13
94 0.12
95 0.12
96 0.16
97 0.16
98 0.23
99 0.27
100 0.3
101 0.38
102 0.44
103 0.44
104 0.41
105 0.41
106 0.36
107 0.33
108 0.31
109 0.22
110 0.17
111 0.2
112 0.17
113 0.17
114 0.15
115 0.14
116 0.13
117 0.15
118 0.14
119 0.12
120 0.11
121 0.14
122 0.17
123 0.18
124 0.2
125 0.19
126 0.21
127 0.22
128 0.23
129 0.27
130 0.34
131 0.43
132 0.47
133 0.56
134 0.6
135 0.64
136 0.65
137 0.6
138 0.55
139 0.49
140 0.48
141 0.43
142 0.35
143 0.31
144 0.27
145 0.24
146 0.19
147 0.16
148 0.1
149 0.07
150 0.07
151 0.07
152 0.08
153 0.1
154 0.16
155 0.23
156 0.31
157 0.36
158 0.44
159 0.47
160 0.52
161 0.55
162 0.51
163 0.46
164 0.4
165 0.36
166 0.35
167 0.38
168 0.36
169 0.36
170 0.39
171 0.4
172 0.42
173 0.4
174 0.4
175 0.39
176 0.39
177 0.39
178 0.35
179 0.35
180 0.33
181 0.33
182 0.25
183 0.2
184 0.16
185 0.11
186 0.12
187 0.11
188 0.15
189 0.21
190 0.3
191 0.34
192 0.41
193 0.52
194 0.6
195 0.69
196 0.75
197 0.78
198 0.81
199 0.87
200 0.9
201 0.9
202 0.9
203 0.87
204 0.86
205 0.86
206 0.85
207 0.82
208 0.82
209 0.8
210 0.8
211 0.81
212 0.79
213 0.76
214 0.71
215 0.72
216 0.73
217 0.73
218 0.65
219 0.66
220 0.68
221 0.71
222 0.72
223 0.66
224 0.61
225 0.57
226 0.59
227 0.61
228 0.58
229 0.52
230 0.53
231 0.52
232 0.49
233 0.44
234 0.4
235 0.31
236 0.27
237 0.24
238 0.27