Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QG90

Protein Details
Accession S7QG90    Localization Confidence High Confidence Score 18.7
NoLS Segment(s)
PositionSequenceProtein Nature
84-105LQQPVKRGRGRPKGSKNKKSATHydrophilic
114-137ETGEKTEKRKRGRPPKPKPETAAABasic
142-165TDEPPAKKRGRGRPPKNPKPETSABasic
NLS Segment(s)
PositionSequence
89-193KRGRGRPKGSKNKKSATSAGGPSTSETGEKTEKRKRGRPPKPKPETAAAAESGTDEPPAKKRGRGRPPKNPKPETSAAAAEREEEGGEAHTGEKRKRGRPPKSKS
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
KEGG gtr:GLOTRDRAFT_126692  -  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSDSGEQDDVTKGAEVDELEEQAPADQPAEAGEEEAGKARVLPVVLRIWFLIDETRVRHPAASLTPPAFVFYLPGAADKSAEELQQPVKRGRGRPKGSKNKKSATSAGGPSTSETGEKTEKRKRGRPPKPKPETAAAAESGTDEPPAKKRGRGRPPKNPKPETSAAAAEREEEGGEAHTGEKRKRGRPPKSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.12
5 0.12
6 0.12
7 0.12
8 0.12
9 0.11
10 0.12
11 0.09
12 0.08
13 0.07
14 0.07
15 0.07
16 0.1
17 0.09
18 0.08
19 0.08
20 0.08
21 0.08
22 0.1
23 0.1
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.09
30 0.11
31 0.14
32 0.15
33 0.16
34 0.15
35 0.15
36 0.14
37 0.15
38 0.13
39 0.1
40 0.12
41 0.14
42 0.18
43 0.19
44 0.19
45 0.19
46 0.18
47 0.2
48 0.21
49 0.22
50 0.21
51 0.2
52 0.2
53 0.2
54 0.21
55 0.17
56 0.14
57 0.11
58 0.08
59 0.09
60 0.08
61 0.09
62 0.08
63 0.08
64 0.08
65 0.07
66 0.1
67 0.09
68 0.09
69 0.09
70 0.1
71 0.15
72 0.17
73 0.2
74 0.18
75 0.23
76 0.27
77 0.33
78 0.42
79 0.47
80 0.51
81 0.59
82 0.68
83 0.74
84 0.81
85 0.84
86 0.81
87 0.77
88 0.75
89 0.69
90 0.62
91 0.54
92 0.48
93 0.41
94 0.35
95 0.29
96 0.24
97 0.21
98 0.19
99 0.15
100 0.1
101 0.09
102 0.1
103 0.15
104 0.18
105 0.25
106 0.32
107 0.39
108 0.45
109 0.53
110 0.6
111 0.67
112 0.75
113 0.79
114 0.82
115 0.87
116 0.88
117 0.87
118 0.8
119 0.75
120 0.69
121 0.61
122 0.53
123 0.43
124 0.34
125 0.28
126 0.24
127 0.19
128 0.14
129 0.11
130 0.1
131 0.1
132 0.15
133 0.21
134 0.22
135 0.27
136 0.36
137 0.46
138 0.56
139 0.66
140 0.71
141 0.76
142 0.86
143 0.9
144 0.92
145 0.88
146 0.81
147 0.78
148 0.74
149 0.66
150 0.59
151 0.54
152 0.45
153 0.41
154 0.37
155 0.29
156 0.25
157 0.22
158 0.17
159 0.12
160 0.1
161 0.09
162 0.1
163 0.09
164 0.09
165 0.13
166 0.18
167 0.21
168 0.28
169 0.35
170 0.43
171 0.53
172 0.63
173 0.7