Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RXP1

Protein Details
Accession S7RXP1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-62GGTGKTPKERKRPKVSRLLEBasic
NLS Segment(s)
PositionSequence
49-56PKERKRPK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, mito_nucl 11.666, cyto 5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_125998  -  
Amino Acid Sequences MTVDYRYGIANSSPDLCLPTVYDIEEEREEERASGVTIVLASGGTGKTPKERKRPKVSRLLEDLVFTLKLKCQKLRGTLVHSPKQSLEVDLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.14
4 0.13
5 0.13
6 0.14
7 0.12
8 0.12
9 0.13
10 0.12
11 0.15
12 0.15
13 0.15
14 0.14
15 0.15
16 0.14
17 0.13
18 0.13
19 0.09
20 0.09
21 0.08
22 0.07
23 0.05
24 0.05
25 0.05
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.05
34 0.11
35 0.19
36 0.27
37 0.37
38 0.47
39 0.56
40 0.67
41 0.77
42 0.78
43 0.81
44 0.79
45 0.75
46 0.72
47 0.65
48 0.55
49 0.46
50 0.39
51 0.29
52 0.25
53 0.19
54 0.13
55 0.13
56 0.19
57 0.22
58 0.25
59 0.3
60 0.36
61 0.43
62 0.5
63 0.53
64 0.54
65 0.59
66 0.64
67 0.65
68 0.61
69 0.56
70 0.48
71 0.47
72 0.4
73 0.33