Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RDL2

Protein Details
Accession S7RDL2    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
244-272APTATKPMPKPKKKAGKGVKKPAGGKKPABasic
NLS Segment(s)
PositionSequence
249-306KPMPKPKKKAGKGVKKPAGGKKPAAGKKPTVGNKVGGTGSRNKTGKANSKGKGKAAAQ
Subcellular Location(s) nucl 15, mito 8, cyto 2
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_122906  -  
Amino Acid Sequences MLQEGIYNITNVSTGRVLAIGPDAASWSELQLWEARRRTAWWRYTTDIPSESLRRSGSSTITSKGVSDVQYEIHLQGLGISIRNSSGEKYVVAQWGASRKGGYDLKPVAAYDTSQYWTFTYQRSLQANYDRGQYSDGQGRGGRSTSTGDVVVKPEPKPQVDAATQVLADANRQLLKQIAASNAMQQQIWMTILAQTLGNGGGGGAHTSGGRGLPNASISPASSRASSPDPKEDRDESEDEGSDAPTATKPMPKPKKKAGKGVKKPAGGKKPAAGKKPTVGNKVGGTGSRNKTGKANSKGKGKAAAQPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.1
5 0.1
6 0.12
7 0.09
8 0.09
9 0.08
10 0.09
11 0.09
12 0.1
13 0.09
14 0.08
15 0.1
16 0.1
17 0.11
18 0.15
19 0.2
20 0.27
21 0.3
22 0.31
23 0.31
24 0.35
25 0.42
26 0.46
27 0.5
28 0.49
29 0.51
30 0.54
31 0.59
32 0.59
33 0.55
34 0.47
35 0.41
36 0.39
37 0.37
38 0.34
39 0.31
40 0.29
41 0.25
42 0.26
43 0.27
44 0.25
45 0.27
46 0.28
47 0.26
48 0.27
49 0.26
50 0.23
51 0.23
52 0.23
53 0.18
54 0.17
55 0.15
56 0.14
57 0.16
58 0.16
59 0.14
60 0.12
61 0.11
62 0.09
63 0.08
64 0.09
65 0.08
66 0.08
67 0.09
68 0.08
69 0.08
70 0.1
71 0.1
72 0.09
73 0.11
74 0.11
75 0.11
76 0.13
77 0.16
78 0.17
79 0.16
80 0.16
81 0.15
82 0.2
83 0.21
84 0.19
85 0.16
86 0.14
87 0.2
88 0.23
89 0.23
90 0.25
91 0.25
92 0.26
93 0.26
94 0.26
95 0.21
96 0.18
97 0.17
98 0.11
99 0.12
100 0.12
101 0.12
102 0.12
103 0.11
104 0.13
105 0.14
106 0.14
107 0.16
108 0.18
109 0.24
110 0.26
111 0.27
112 0.28
113 0.32
114 0.34
115 0.32
116 0.33
117 0.27
118 0.25
119 0.24
120 0.21
121 0.18
122 0.2
123 0.19
124 0.17
125 0.17
126 0.18
127 0.17
128 0.17
129 0.14
130 0.1
131 0.11
132 0.1
133 0.1
134 0.1
135 0.1
136 0.1
137 0.12
138 0.13
139 0.14
140 0.14
141 0.17
142 0.19
143 0.19
144 0.21
145 0.2
146 0.22
147 0.2
148 0.21
149 0.18
150 0.16
151 0.15
152 0.13
153 0.13
154 0.08
155 0.08
156 0.06
157 0.06
158 0.07
159 0.07
160 0.07
161 0.08
162 0.08
163 0.1
164 0.11
165 0.11
166 0.13
167 0.13
168 0.16
169 0.17
170 0.17
171 0.15
172 0.13
173 0.13
174 0.11
175 0.11
176 0.08
177 0.06
178 0.06
179 0.07
180 0.07
181 0.07
182 0.06
183 0.06
184 0.06
185 0.06
186 0.04
187 0.04
188 0.03
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.07
201 0.08
202 0.09
203 0.09
204 0.09
205 0.09
206 0.11
207 0.13
208 0.14
209 0.13
210 0.13
211 0.16
212 0.21
213 0.26
214 0.27
215 0.34
216 0.37
217 0.39
218 0.44
219 0.43
220 0.43
221 0.43
222 0.42
223 0.35
224 0.34
225 0.31
226 0.26
227 0.24
228 0.2
229 0.15
230 0.13
231 0.1
232 0.08
233 0.1
234 0.11
235 0.16
236 0.2
237 0.31
238 0.42
239 0.5
240 0.58
241 0.67
242 0.76
243 0.77
244 0.84
245 0.84
246 0.85
247 0.86
248 0.89
249 0.87
250 0.83
251 0.83
252 0.82
253 0.81
254 0.76
255 0.69
256 0.63
257 0.66
258 0.66
259 0.66
260 0.61
261 0.56
262 0.57
263 0.63
264 0.64
265 0.6
266 0.56
267 0.53
268 0.49
269 0.48
270 0.44
271 0.36
272 0.32
273 0.36
274 0.37
275 0.42
276 0.41
277 0.39
278 0.44
279 0.51
280 0.57
281 0.58
282 0.62
283 0.6
284 0.69
285 0.72
286 0.7
287 0.7
288 0.62