Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RV24

Protein Details
Accession S7RV24    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-129GNPKTLRRVGRSRKWYRAREESRQAKRKREQEQEQEMEHydrophilic
NLS Segment(s)
PositionSequence
98-120RRVGRSRKWYRAREESRQAKRKR
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
KEGG gtr:GLOTRDRAFT_137489  -  
Amino Acid Sequences MSDSSSDIFSSEDEDSISISAFPPTCHPPAMQISLPPSSHFMDFHDRAQLTPISETSEMDEDEDEDEEQTPALDTASQTPSLTSASSVESYGNPKTLRRVGRSRKWYRAREESRQAKRKREQEQEQEMEMDLLDSGSESESEYSDSEEGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.11
5 0.07
6 0.07
7 0.1
8 0.1
9 0.11
10 0.14
11 0.19
12 0.2
13 0.22
14 0.21
15 0.23
16 0.28
17 0.32
18 0.28
19 0.26
20 0.27
21 0.3
22 0.3
23 0.26
24 0.24
25 0.21
26 0.21
27 0.19
28 0.19
29 0.24
30 0.25
31 0.25
32 0.29
33 0.27
34 0.26
35 0.28
36 0.26
37 0.18
38 0.18
39 0.17
40 0.14
41 0.14
42 0.14
43 0.13
44 0.13
45 0.12
46 0.11
47 0.11
48 0.08
49 0.08
50 0.09
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.07
63 0.08
64 0.09
65 0.08
66 0.08
67 0.09
68 0.09
69 0.09
70 0.07
71 0.06
72 0.07
73 0.08
74 0.08
75 0.08
76 0.09
77 0.12
78 0.12
79 0.15
80 0.14
81 0.14
82 0.19
83 0.25
84 0.29
85 0.33
86 0.43
87 0.49
88 0.58
89 0.69
90 0.72
91 0.76
92 0.8
93 0.81
94 0.79
95 0.8
96 0.78
97 0.77
98 0.79
99 0.79
100 0.8
101 0.83
102 0.81
103 0.8
104 0.81
105 0.8
106 0.79
107 0.8
108 0.79
109 0.79
110 0.84
111 0.78
112 0.71
113 0.63
114 0.53
115 0.43
116 0.32
117 0.22
118 0.12
119 0.07
120 0.05
121 0.04
122 0.04
123 0.05
124 0.05
125 0.06
126 0.07
127 0.07
128 0.09
129 0.1
130 0.12