Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7REP3

Protein Details
Accession S7REP3    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
74-93LTKADSPHKRVKKVKDILPKBasic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12.333, mito_nucl 11.499, mito 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029756  MTH1187/YkoF-like  
IPR002767  Thiamine_BP  
KEGG gtr:GLOTRDRAFT_8019  -  
Pfam View protein in Pfam  
PF01910  Thiamine_BP  
Amino Acid Sequences DFSLTPVGTGSPSLLHISEYIAECYRVLETTGVSYQVSLSKKCQVCLAMQQCHSVLHQKGAPRVCTAVHIETSLTKADSPHKRVKKVKDILPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.11
5 0.13
6 0.14
7 0.14
8 0.14
9 0.14
10 0.13
11 0.14
12 0.13
13 0.11
14 0.1
15 0.08
16 0.08
17 0.1
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.13
24 0.15
25 0.14
26 0.15
27 0.22
28 0.23
29 0.24
30 0.25
31 0.21
32 0.21
33 0.28
34 0.33
35 0.29
36 0.29
37 0.3
38 0.28
39 0.28
40 0.27
41 0.24
42 0.18
43 0.17
44 0.18
45 0.2
46 0.25
47 0.28
48 0.29
49 0.24
50 0.25
51 0.22
52 0.23
53 0.24
54 0.21
55 0.18
56 0.17
57 0.17
58 0.16
59 0.18
60 0.16
61 0.13
62 0.11
63 0.12
64 0.21
65 0.3
66 0.36
67 0.45
68 0.52
69 0.61
70 0.69
71 0.77
72 0.79
73 0.79