Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QLF9

Protein Details
Accession S7QLF9    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
25-53KHKLPDKPATETARKKRRRTSAEPGSFDDBasic
465-484NSRPSHTVSRDDYRRNRRQRHydrophilic
NLS Segment(s)
PositionSequence
22-43APPKHKLPDKPATETARKKRRR
Subcellular Location(s) nucl 9cyto_nucl 9, cyto 7, pero 4, plas 3, mito 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
IPR002058  PAP_assoc  
IPR045862  Trf4-like  
Gene Ontology GO:0031499  C:TRAMP complex  
GO:0046872  F:metal ion binding  
GO:1990817  F:poly(A) RNA polymerase activity  
GO:0043631  P:RNA polyadenylation  
KEGG gtr:GLOTRDRAFT_118556  -  
Pfam View protein in Pfam  
PF03828  PAP_assoc  
CDD cd05402  NT_PAP_TUTase  
Amino Acid Sequences MASTSMPLPDFIPLDDGVSHRAPPKHKLPDKPATETARKKRRRTSAEPGSFDDHSHTPWIDALGITEYESKEQRLHDEIVAFVKYVDPTPQETSARKLVIGRISEIVRERFRNSRVEVFGSIAQNLCLPDSIPGDKKEANRALFQLRNRFKDAGISEDAFVVSRARVPIINMSTTPAFGRSCKIDLSVNNNTGLHVIEVLKGYLEKMPALRPLILVLKGFLTQRKLNSAADAGLGSFALISMIISFLQLNPSKLPRDIIDQPIQNESLGRLLLDFFYYYGYTFPYRTSYISVTDAKLDLKETKGWFRTESPEALSIQSMIDPDRDIGSGTTRIEAIRVAFRQAFNTLNNFPFTISSANVLGNVLGFSGKTIAQREHLRQMIDSGALQRAIKPPNASRSRYPPRGSRGRSPAYAPRDYLAPPPQADYGHRPYYGPPSPAYDDYYRYPPPQYGPELPPHPYGDYGYNSRPSHTVSRDDYRRNRRQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.18
5 0.19
6 0.21
7 0.24
8 0.3
9 0.33
10 0.39
11 0.48
12 0.54
13 0.61
14 0.68
15 0.71
16 0.76
17 0.78
18 0.78
19 0.76
20 0.73
21 0.76
22 0.76
23 0.77
24 0.78
25 0.81
26 0.82
27 0.83
28 0.86
29 0.86
30 0.84
31 0.85
32 0.85
33 0.86
34 0.81
35 0.76
36 0.7
37 0.61
38 0.52
39 0.46
40 0.36
41 0.28
42 0.27
43 0.23
44 0.18
45 0.19
46 0.19
47 0.15
48 0.13
49 0.13
50 0.12
51 0.11
52 0.12
53 0.14
54 0.14
55 0.16
56 0.18
57 0.18
58 0.19
59 0.2
60 0.24
61 0.25
62 0.27
63 0.26
64 0.26
65 0.26
66 0.26
67 0.25
68 0.21
69 0.16
70 0.15
71 0.13
72 0.13
73 0.15
74 0.14
75 0.18
76 0.22
77 0.26
78 0.28
79 0.29
80 0.33
81 0.36
82 0.34
83 0.31
84 0.29
85 0.3
86 0.31
87 0.31
88 0.29
89 0.27
90 0.26
91 0.28
92 0.3
93 0.31
94 0.29
95 0.31
96 0.32
97 0.35
98 0.38
99 0.42
100 0.42
101 0.44
102 0.42
103 0.43
104 0.4
105 0.36
106 0.37
107 0.32
108 0.28
109 0.21
110 0.18
111 0.16
112 0.15
113 0.13
114 0.08
115 0.08
116 0.09
117 0.12
118 0.15
119 0.17
120 0.19
121 0.23
122 0.27
123 0.28
124 0.35
125 0.39
126 0.37
127 0.36
128 0.38
129 0.4
130 0.41
131 0.44
132 0.45
133 0.45
134 0.47
135 0.49
136 0.47
137 0.41
138 0.43
139 0.39
140 0.34
141 0.31
142 0.27
143 0.23
144 0.22
145 0.22
146 0.15
147 0.15
148 0.1
149 0.07
150 0.08
151 0.08
152 0.08
153 0.09
154 0.1
155 0.15
156 0.17
157 0.18
158 0.16
159 0.18
160 0.17
161 0.17
162 0.17
163 0.13
164 0.12
165 0.11
166 0.13
167 0.13
168 0.14
169 0.14
170 0.16
171 0.17
172 0.19
173 0.26
174 0.3
175 0.29
176 0.29
177 0.28
178 0.27
179 0.24
180 0.21
181 0.13
182 0.09
183 0.08
184 0.08
185 0.08
186 0.08
187 0.07
188 0.07
189 0.07
190 0.08
191 0.08
192 0.07
193 0.08
194 0.1
195 0.13
196 0.14
197 0.14
198 0.12
199 0.14
200 0.15
201 0.15
202 0.13
203 0.11
204 0.1
205 0.11
206 0.12
207 0.12
208 0.14
209 0.15
210 0.16
211 0.19
212 0.21
213 0.2
214 0.2
215 0.19
216 0.15
217 0.13
218 0.12
219 0.09
220 0.06
221 0.06
222 0.04
223 0.03
224 0.03
225 0.02
226 0.02
227 0.02
228 0.02
229 0.02
230 0.03
231 0.03
232 0.03
233 0.03
234 0.08
235 0.09
236 0.1
237 0.11
238 0.13
239 0.15
240 0.15
241 0.16
242 0.13
243 0.18
244 0.21
245 0.24
246 0.27
247 0.27
248 0.28
249 0.28
250 0.28
251 0.22
252 0.18
253 0.14
254 0.1
255 0.08
256 0.07
257 0.05
258 0.06
259 0.06
260 0.06
261 0.06
262 0.04
263 0.06
264 0.06
265 0.06
266 0.06
267 0.08
268 0.08
269 0.09
270 0.09
271 0.11
272 0.13
273 0.13
274 0.16
275 0.15
276 0.16
277 0.2
278 0.21
279 0.18
280 0.18
281 0.18
282 0.16
283 0.15
284 0.15
285 0.13
286 0.12
287 0.16
288 0.17
289 0.23
290 0.26
291 0.27
292 0.28
293 0.29
294 0.32
295 0.31
296 0.3
297 0.26
298 0.25
299 0.24
300 0.22
301 0.2
302 0.15
303 0.12
304 0.11
305 0.09
306 0.08
307 0.07
308 0.07
309 0.08
310 0.08
311 0.08
312 0.08
313 0.08
314 0.1
315 0.12
316 0.12
317 0.12
318 0.12
319 0.12
320 0.11
321 0.12
322 0.11
323 0.14
324 0.14
325 0.17
326 0.19
327 0.19
328 0.21
329 0.22
330 0.23
331 0.19
332 0.23
333 0.23
334 0.22
335 0.23
336 0.22
337 0.2
338 0.18
339 0.18
340 0.15
341 0.12
342 0.12
343 0.12
344 0.12
345 0.12
346 0.11
347 0.1
348 0.08
349 0.07
350 0.06
351 0.04
352 0.04
353 0.04
354 0.06
355 0.07
356 0.1
357 0.13
358 0.14
359 0.2
360 0.26
361 0.31
362 0.37
363 0.39
364 0.37
365 0.35
366 0.35
367 0.3
368 0.25
369 0.22
370 0.16
371 0.15
372 0.16
373 0.15
374 0.17
375 0.21
376 0.23
377 0.26
378 0.28
379 0.32
380 0.41
381 0.48
382 0.5
383 0.5
384 0.58
385 0.65
386 0.68
387 0.68
388 0.65
389 0.68
390 0.74
391 0.74
392 0.73
393 0.72
394 0.7
395 0.67
396 0.65
397 0.64
398 0.61
399 0.58
400 0.5
401 0.41
402 0.38
403 0.37
404 0.38
405 0.36
406 0.33
407 0.3
408 0.32
409 0.33
410 0.32
411 0.35
412 0.36
413 0.37
414 0.37
415 0.37
416 0.35
417 0.36
418 0.43
419 0.45
420 0.4
421 0.34
422 0.35
423 0.39
424 0.41
425 0.43
426 0.37
427 0.35
428 0.37
429 0.42
430 0.39
431 0.37
432 0.37
433 0.35
434 0.37
435 0.39
436 0.42
437 0.43
438 0.44
439 0.5
440 0.51
441 0.51
442 0.51
443 0.47
444 0.42
445 0.36
446 0.34
447 0.31
448 0.32
449 0.34
450 0.35
451 0.41
452 0.4
453 0.41
454 0.4
455 0.4
456 0.44
457 0.43
458 0.45
459 0.44
460 0.54
461 0.6
462 0.69
463 0.74
464 0.76