Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7RGC4

Protein Details
Accession S7RGC4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
319-343SAPRMHPTRYARRPWYKPKPTSLGTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, extr 6, mito 3, cyto 3, golg 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046366  MPAB  
Gene Ontology GO:0016020  C:membrane  
GO:0016491  F:oxidoreductase activity  
KEGG gtr:GLOTRDRAFT_46084  -  
Amino Acid Sequences MQLLNWWPWPKSALFIVLLVVYLGIVQALRWRRYHEVHKKYGPRISSLTPAEAQQIIHLSSQWDMPALVTIALSFALFKTYAIPTISGLLSKTRQLGARENVSRRYADTEILITTWVTCPISGKFDFDPRAASGSKRGEEEEFDPRCAIAIARTNWLHGKYDIKWMKRYGWRELSELEKQAYFVFWIEVGRRMNITDIPQTLGDLERWSANYEEGYMIPAQTNHHVAQLTVDEFLWFAPEKFGIKDFLQRIVICMLEDRVRIAMISPCIFRYKEQPWSLHAIARGLTGGFAFFQRYCLLPRRSPSLFVKDDTPKHSPDSAPRMHPTRYARRPWYKPKPTSLGTFIERFTVAVGLVDAENVASPRNKCEGFRLEEIGPESFEKSGHEETMRIAGELQGCPVRGPWSLNPHKLHRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.19
5 0.18
6 0.14
7 0.11
8 0.07
9 0.05
10 0.05
11 0.04
12 0.03
13 0.03
14 0.1
15 0.18
16 0.22
17 0.24
18 0.29
19 0.36
20 0.44
21 0.55
22 0.59
23 0.62
24 0.68
25 0.76
26 0.8
27 0.8
28 0.79
29 0.7
30 0.64
31 0.59
32 0.53
33 0.51
34 0.45
35 0.42
36 0.37
37 0.35
38 0.33
39 0.29
40 0.26
41 0.19
42 0.19
43 0.17
44 0.16
45 0.16
46 0.14
47 0.13
48 0.14
49 0.13
50 0.11
51 0.09
52 0.09
53 0.1
54 0.1
55 0.09
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.09
67 0.1
68 0.13
69 0.14
70 0.14
71 0.13
72 0.16
73 0.16
74 0.14
75 0.14
76 0.15
77 0.15
78 0.17
79 0.19
80 0.19
81 0.23
82 0.25
83 0.33
84 0.35
85 0.42
86 0.47
87 0.49
88 0.51
89 0.49
90 0.46
91 0.4
92 0.4
93 0.32
94 0.26
95 0.23
96 0.19
97 0.17
98 0.17
99 0.16
100 0.1
101 0.1
102 0.09
103 0.1
104 0.08
105 0.08
106 0.1
107 0.11
108 0.16
109 0.16
110 0.18
111 0.18
112 0.24
113 0.27
114 0.25
115 0.26
116 0.22
117 0.25
118 0.22
119 0.21
120 0.23
121 0.25
122 0.26
123 0.25
124 0.26
125 0.23
126 0.25
127 0.28
128 0.3
129 0.27
130 0.26
131 0.25
132 0.23
133 0.22
134 0.2
135 0.17
136 0.1
137 0.15
138 0.16
139 0.21
140 0.21
141 0.22
142 0.24
143 0.26
144 0.24
145 0.19
146 0.22
147 0.18
148 0.29
149 0.33
150 0.34
151 0.37
152 0.37
153 0.43
154 0.46
155 0.48
156 0.46
157 0.49
158 0.48
159 0.46
160 0.45
161 0.43
162 0.39
163 0.36
164 0.29
165 0.2
166 0.19
167 0.17
168 0.15
169 0.11
170 0.08
171 0.06
172 0.06
173 0.07
174 0.07
175 0.11
176 0.12
177 0.12
178 0.12
179 0.12
180 0.12
181 0.13
182 0.14
183 0.13
184 0.13
185 0.13
186 0.13
187 0.13
188 0.12
189 0.11
190 0.09
191 0.07
192 0.07
193 0.06
194 0.07
195 0.08
196 0.08
197 0.08
198 0.07
199 0.07
200 0.08
201 0.07
202 0.08
203 0.07
204 0.06
205 0.06
206 0.07
207 0.08
208 0.09
209 0.12
210 0.11
211 0.13
212 0.13
213 0.12
214 0.13
215 0.13
216 0.12
217 0.09
218 0.09
219 0.07
220 0.07
221 0.07
222 0.07
223 0.06
224 0.06
225 0.06
226 0.07
227 0.08
228 0.09
229 0.1
230 0.11
231 0.12
232 0.18
233 0.19
234 0.22
235 0.23
236 0.22
237 0.23
238 0.21
239 0.2
240 0.13
241 0.13
242 0.11
243 0.1
244 0.11
245 0.1
246 0.09
247 0.09
248 0.09
249 0.09
250 0.11
251 0.11
252 0.13
253 0.13
254 0.14
255 0.17
256 0.17
257 0.17
258 0.21
259 0.24
260 0.31
261 0.35
262 0.36
263 0.36
264 0.43
265 0.43
266 0.39
267 0.35
268 0.26
269 0.22
270 0.21
271 0.18
272 0.11
273 0.1
274 0.07
275 0.06
276 0.05
277 0.06
278 0.07
279 0.07
280 0.09
281 0.1
282 0.11
283 0.14
284 0.23
285 0.28
286 0.3
287 0.33
288 0.39
289 0.39
290 0.44
291 0.46
292 0.46
293 0.43
294 0.4
295 0.44
296 0.44
297 0.48
298 0.48
299 0.46
300 0.39
301 0.41
302 0.43
303 0.38
304 0.39
305 0.43
306 0.42
307 0.44
308 0.48
309 0.49
310 0.47
311 0.51
312 0.51
313 0.53
314 0.57
315 0.61
316 0.66
317 0.71
318 0.8
319 0.84
320 0.87
321 0.86
322 0.85
323 0.84
324 0.82
325 0.75
326 0.71
327 0.65
328 0.6
329 0.53
330 0.48
331 0.4
332 0.34
333 0.31
334 0.25
335 0.2
336 0.15
337 0.11
338 0.08
339 0.08
340 0.07
341 0.07
342 0.07
343 0.06
344 0.05
345 0.06
346 0.06
347 0.08
348 0.11
349 0.13
350 0.17
351 0.23
352 0.25
353 0.26
354 0.34
355 0.4
356 0.42
357 0.45
358 0.45
359 0.4
360 0.42
361 0.43
362 0.36
363 0.3
364 0.24
365 0.22
366 0.17
367 0.17
368 0.15
369 0.18
370 0.2
371 0.22
372 0.22
373 0.21
374 0.23
375 0.3
376 0.28
377 0.23
378 0.2
379 0.2
380 0.23
381 0.22
382 0.24
383 0.2
384 0.2
385 0.2
386 0.21
387 0.21
388 0.2
389 0.25
390 0.28
391 0.37
392 0.45
393 0.53
394 0.58