Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7RDT5

Protein Details
Accession S7RDT5    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
297-318QSRMRQTKTKFRKGWKKLNDFMHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 6, mito 3, nucl 1.5, cyto_nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004776  Mem_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0055085  P:transmembrane transport  
KEGG gtr:GLOTRDRAFT_117738  -  
Pfam View protein in Pfam  
PF03547  Mem_trans  
Amino Acid Sequences MGSPLDTPILPLLKVVFESILEVFLLCLAGYILARKGVLDKKTQKQLNRVNVSLFTPSLLFSKVAFFLSPAKLKELWIIPIFFTVTTVASMAVAYVLGVTFRLKRSQRSFAIAAAMFMNSNSLPIALMQSLVITVPGLKWGDDDNKDAMVGRALTYLVLHSTMGMVLRWSYGVRLLAQADPEPVEMRDTNEATPLLEPDETAFPPSAEEEQIHRHEYPEQRQTSTSSSTQVSGKSTPEITVARPNDHLKPDAAYQPKDRAADDTTSAEYDSATIDDDDSDELLIGRPVTEPTSSRFQSRMRQTKTKFRKGWKKLNDFMTAPLWAALASLIVALIQPLQHIMNEHLVPVKGALNSAGNCSIPITLVVLGAYFYTPPDPESNKRKLPTHSSDGGLRSVPSQVSLAGHMKNMFARAKRSQGIRTLMNASGDEGKRPGETKTVFIAVLARMVITPLVLLPAMALSAKFDWQRVLEDPVFVVSNVLLISSPPALTLAQITQAASGDAFERLISRTIFWAYCVVTPPATIIFVVVGLLLSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.12
4 0.1
5 0.13
6 0.12
7 0.12
8 0.1
9 0.1
10 0.08
11 0.08
12 0.08
13 0.05
14 0.05
15 0.04
16 0.06
17 0.06
18 0.08
19 0.09
20 0.1
21 0.1
22 0.1
23 0.17
24 0.23
25 0.27
26 0.35
27 0.43
28 0.51
29 0.61
30 0.67
31 0.67
32 0.71
33 0.77
34 0.77
35 0.76
36 0.69
37 0.62
38 0.58
39 0.53
40 0.46
41 0.36
42 0.26
43 0.19
44 0.18
45 0.16
46 0.16
47 0.14
48 0.12
49 0.15
50 0.15
51 0.16
52 0.15
53 0.15
54 0.19
55 0.24
56 0.28
57 0.26
58 0.29
59 0.29
60 0.29
61 0.34
62 0.31
63 0.31
64 0.29
65 0.29
66 0.25
67 0.26
68 0.26
69 0.19
70 0.18
71 0.13
72 0.1
73 0.1
74 0.1
75 0.08
76 0.07
77 0.07
78 0.06
79 0.05
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.04
86 0.06
87 0.09
88 0.11
89 0.2
90 0.22
91 0.32
92 0.38
93 0.47
94 0.49
95 0.53
96 0.52
97 0.46
98 0.49
99 0.4
100 0.34
101 0.25
102 0.22
103 0.15
104 0.13
105 0.13
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.08
113 0.06
114 0.07
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.04
121 0.04
122 0.04
123 0.07
124 0.08
125 0.08
126 0.09
127 0.12
128 0.19
129 0.2
130 0.23
131 0.21
132 0.21
133 0.21
134 0.21
135 0.18
136 0.13
137 0.12
138 0.09
139 0.09
140 0.08
141 0.08
142 0.08
143 0.08
144 0.07
145 0.07
146 0.06
147 0.05
148 0.05
149 0.06
150 0.06
151 0.06
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.06
158 0.08
159 0.09
160 0.09
161 0.11
162 0.12
163 0.13
164 0.14
165 0.14
166 0.13
167 0.12
168 0.12
169 0.11
170 0.1
171 0.11
172 0.11
173 0.12
174 0.15
175 0.16
176 0.15
177 0.16
178 0.16
179 0.14
180 0.14
181 0.13
182 0.1
183 0.09
184 0.08
185 0.08
186 0.11
187 0.1
188 0.11
189 0.11
190 0.09
191 0.1
192 0.11
193 0.1
194 0.09
195 0.09
196 0.1
197 0.16
198 0.18
199 0.2
200 0.19
201 0.19
202 0.24
203 0.29
204 0.34
205 0.37
206 0.37
207 0.36
208 0.37
209 0.38
210 0.35
211 0.34
212 0.28
213 0.22
214 0.2
215 0.21
216 0.21
217 0.2
218 0.19
219 0.16
220 0.16
221 0.15
222 0.15
223 0.14
224 0.15
225 0.15
226 0.14
227 0.2
228 0.2
229 0.2
230 0.23
231 0.25
232 0.26
233 0.27
234 0.27
235 0.2
236 0.2
237 0.2
238 0.24
239 0.25
240 0.24
241 0.24
242 0.27
243 0.3
244 0.29
245 0.27
246 0.24
247 0.22
248 0.21
249 0.2
250 0.17
251 0.15
252 0.14
253 0.14
254 0.11
255 0.08
256 0.07
257 0.06
258 0.05
259 0.05
260 0.04
261 0.04
262 0.04
263 0.05
264 0.05
265 0.04
266 0.04
267 0.04
268 0.04
269 0.04
270 0.04
271 0.04
272 0.04
273 0.04
274 0.05
275 0.06
276 0.07
277 0.08
278 0.11
279 0.18
280 0.18
281 0.2
282 0.22
283 0.24
284 0.32
285 0.41
286 0.48
287 0.47
288 0.56
289 0.58
290 0.66
291 0.73
292 0.75
293 0.72
294 0.72
295 0.77
296 0.77
297 0.84
298 0.83
299 0.81
300 0.77
301 0.76
302 0.71
303 0.6
304 0.53
305 0.45
306 0.35
307 0.26
308 0.2
309 0.14
310 0.09
311 0.08
312 0.06
313 0.04
314 0.03
315 0.03
316 0.03
317 0.02
318 0.02
319 0.02
320 0.03
321 0.03
322 0.03
323 0.04
324 0.05
325 0.05
326 0.06
327 0.08
328 0.12
329 0.12
330 0.12
331 0.13
332 0.13
333 0.13
334 0.13
335 0.13
336 0.09
337 0.09
338 0.1
339 0.11
340 0.11
341 0.13
342 0.13
343 0.11
344 0.11
345 0.12
346 0.11
347 0.08
348 0.08
349 0.07
350 0.06
351 0.06
352 0.06
353 0.06
354 0.06
355 0.05
356 0.05
357 0.04
358 0.04
359 0.05
360 0.06
361 0.07
362 0.12
363 0.17
364 0.24
365 0.32
366 0.39
367 0.45
368 0.49
369 0.52
370 0.53
371 0.58
372 0.58
373 0.57
374 0.53
375 0.49
376 0.49
377 0.46
378 0.42
379 0.33
380 0.26
381 0.19
382 0.18
383 0.16
384 0.13
385 0.11
386 0.1
387 0.11
388 0.14
389 0.16
390 0.15
391 0.17
392 0.16
393 0.17
394 0.17
395 0.21
396 0.22
397 0.21
398 0.27
399 0.3
400 0.35
401 0.39
402 0.43
403 0.43
404 0.46
405 0.48
406 0.44
407 0.43
408 0.41
409 0.38
410 0.34
411 0.3
412 0.24
413 0.27
414 0.25
415 0.23
416 0.2
417 0.19
418 0.19
419 0.2
420 0.2
421 0.2
422 0.21
423 0.23
424 0.26
425 0.26
426 0.25
427 0.24
428 0.25
429 0.17
430 0.17
431 0.14
432 0.11
433 0.09
434 0.09
435 0.09
436 0.06
437 0.06
438 0.04
439 0.05
440 0.05
441 0.05
442 0.04
443 0.05
444 0.05
445 0.05
446 0.05
447 0.06
448 0.07
449 0.12
450 0.13
451 0.13
452 0.16
453 0.17
454 0.21
455 0.21
456 0.27
457 0.25
458 0.24
459 0.24
460 0.23
461 0.23
462 0.19
463 0.17
464 0.09
465 0.09
466 0.08
467 0.08
468 0.06
469 0.06
470 0.08
471 0.08
472 0.09
473 0.08
474 0.09
475 0.09
476 0.09
477 0.12
478 0.1
479 0.12
480 0.13
481 0.14
482 0.13
483 0.14
484 0.13
485 0.11
486 0.11
487 0.09
488 0.08
489 0.08
490 0.08
491 0.09
492 0.1
493 0.14
494 0.14
495 0.14
496 0.16
497 0.2
498 0.2
499 0.2
500 0.22
501 0.21
502 0.23
503 0.25
504 0.24
505 0.21
506 0.21
507 0.21
508 0.19
509 0.18
510 0.15
511 0.12
512 0.1
513 0.09
514 0.09
515 0.07
516 0.06