Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7QEU1

Protein Details
Accession S7QEU1    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-63VTRGAGFRKEKNKKKRGSYRGGEITBasic
NLS Segment(s)
PositionSequence
44-55GFRKEKNKKKRG
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG gtr:GLOTRDRAFT_36343  -  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences RIKPEKVKFADERLKDNSYQSKGGPQNDYGDKAHRDLIVTRGAGFRKEKNKKKRGSYRGGEITMESHSIKFTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.47
3 0.48
4 0.46
5 0.41
6 0.4
7 0.35
8 0.38
9 0.4
10 0.43
11 0.4
12 0.33
13 0.35
14 0.35
15 0.37
16 0.3
17 0.29
18 0.26
19 0.24
20 0.25
21 0.2
22 0.19
23 0.16
24 0.17
25 0.16
26 0.15
27 0.15
28 0.16
29 0.16
30 0.18
31 0.2
32 0.24
33 0.31
34 0.42
35 0.51
36 0.59
37 0.68
38 0.74
39 0.82
40 0.87
41 0.86
42 0.86
43 0.82
44 0.81
45 0.79
46 0.73
47 0.63
48 0.52
49 0.44
50 0.35
51 0.31
52 0.22
53 0.15