Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S7RFH0

Protein Details
Accession S7RFH0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-85SIAYKGIRNLKKNKVKRRRAATVNIDRVRHydrophilic
NLS Segment(s)
PositionSequence
64-75RNLKKNKVKRRR
Subcellular Location(s) nucl 10.5, cyto_nucl 9, pero 7, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
KEGG gtr:GLOTRDRAFT_46143  -  
Pfam View protein in Pfam  
PF00075  RNase_H  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences AATHFQWIKGHSGHPGNEAADALAKEGARKDIPDNIDITVPDKFCLEGAKLSELTQSIAYKGIRNLKKNKVKRRRAATVNIDRVRYGIHEITHQLETDSQIWQSWRNRNLRPEIRQYLHKAFHGTQKIGDYWDPIPNYGHRAVCPYCGDTTETMEHIWLECDAPERRIIWHLAASLWPEQNGPWPNLAFGAILGCGKLSIPTSNAPNAEQNPGAEQGDGPGRKHTAAGMSRLLQILVSESAHLIWALRCLRVIQEKTLSPRAICARWMNNINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.32
4 0.3
5 0.28
6 0.21
7 0.18
8 0.17
9 0.14
10 0.14
11 0.13
12 0.14
13 0.16
14 0.19
15 0.17
16 0.19
17 0.21
18 0.26
19 0.29
20 0.29
21 0.28
22 0.25
23 0.26
24 0.24
25 0.23
26 0.2
27 0.18
28 0.16
29 0.15
30 0.14
31 0.13
32 0.15
33 0.15
34 0.14
35 0.16
36 0.19
37 0.19
38 0.2
39 0.21
40 0.19
41 0.19
42 0.18
43 0.16
44 0.13
45 0.16
46 0.17
47 0.18
48 0.22
49 0.3
50 0.34
51 0.41
52 0.49
53 0.56
54 0.66
55 0.73
56 0.79
57 0.81
58 0.85
59 0.87
60 0.88
61 0.87
62 0.83
63 0.83
64 0.82
65 0.81
66 0.81
67 0.75
68 0.66
69 0.56
70 0.49
71 0.4
72 0.31
73 0.25
74 0.16
75 0.14
76 0.15
77 0.17
78 0.19
79 0.19
80 0.18
81 0.14
82 0.13
83 0.14
84 0.14
85 0.13
86 0.1
87 0.1
88 0.11
89 0.17
90 0.23
91 0.27
92 0.34
93 0.39
94 0.44
95 0.48
96 0.57
97 0.59
98 0.59
99 0.6
100 0.6
101 0.56
102 0.56
103 0.57
104 0.53
105 0.48
106 0.43
107 0.38
108 0.33
109 0.38
110 0.37
111 0.31
112 0.26
113 0.25
114 0.24
115 0.22
116 0.21
117 0.16
118 0.13
119 0.17
120 0.15
121 0.14
122 0.15
123 0.14
124 0.18
125 0.18
126 0.17
127 0.13
128 0.18
129 0.18
130 0.19
131 0.2
132 0.17
133 0.15
134 0.15
135 0.16
136 0.13
137 0.15
138 0.13
139 0.13
140 0.11
141 0.11
142 0.1
143 0.09
144 0.09
145 0.06
146 0.05
147 0.05
148 0.09
149 0.1
150 0.11
151 0.12
152 0.12
153 0.13
154 0.15
155 0.16
156 0.13
157 0.14
158 0.14
159 0.13
160 0.13
161 0.14
162 0.15
163 0.14
164 0.13
165 0.11
166 0.11
167 0.18
168 0.19
169 0.18
170 0.18
171 0.17
172 0.17
173 0.17
174 0.18
175 0.11
176 0.08
177 0.08
178 0.06
179 0.06
180 0.05
181 0.05
182 0.04
183 0.04
184 0.05
185 0.06
186 0.07
187 0.09
188 0.12
189 0.15
190 0.19
191 0.2
192 0.2
193 0.24
194 0.25
195 0.26
196 0.24
197 0.21
198 0.21
199 0.22
200 0.21
201 0.16
202 0.14
203 0.12
204 0.19
205 0.2
206 0.19
207 0.2
208 0.21
209 0.21
210 0.22
211 0.21
212 0.22
213 0.23
214 0.26
215 0.27
216 0.27
217 0.29
218 0.29
219 0.27
220 0.19
221 0.16
222 0.15
223 0.12
224 0.11
225 0.09
226 0.09
227 0.09
228 0.1
229 0.1
230 0.08
231 0.07
232 0.13
233 0.15
234 0.15
235 0.16
236 0.16
237 0.22
238 0.31
239 0.33
240 0.32
241 0.37
242 0.41
243 0.48
244 0.55
245 0.52
246 0.42
247 0.46
248 0.47
249 0.43
250 0.43
251 0.44
252 0.41
253 0.47