Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S7S048

Protein Details
Accession S7S048    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-80LAERKKRWPSASKVEEKKRKVBasic
227-247AKPVRKPFVPQPKKPPNNPFGHydrophilic
NLS Segment(s)
PositionSequence
63-79RKKRWPSASKVEEKKRK
97-133GRKKRRLDDGGGGRGRVRGRGRGRGDSGWGRGRGRGG
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019496  NUFIP1_cons_dom  
KEGG gtr:GLOTRDRAFT_118856  -  
Pfam View protein in Pfam  
PF10453  NUFIP1  
Amino Acid Sequences MGSKKSVEIHMMDRHLIYPPGWEKRQKNDWDADPSLKGKPVPIPGTGLTLDTPEALDAWLAERKKRWPSASKVEEKKRKVEEAIERGQLDPSLSLDGRKKRRLDDGGGGRGRVRGRGRGRGDSGWGRGRGRGGASVPATREPNVSGPLPPAGLPPKPVTVQDSNPTDSDSDSDDAPEAVSFKPPAGLLDSYASSEDEESKAREPVDAEPDPPIPAMTQQPPVTEPPAKPVRKPFVPQPKKPPNNPFGSRPSLLRRLLLPEIRVTVSNFSQAIHFLVENDFLENVEMKPGQASEKMIEVIGESNIADHTSGGAEKLDDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.29
4 0.22
5 0.24
6 0.28
7 0.35
8 0.4
9 0.48
10 0.51
11 0.59
12 0.69
13 0.68
14 0.67
15 0.66
16 0.67
17 0.66
18 0.65
19 0.59
20 0.53
21 0.49
22 0.45
23 0.4
24 0.34
25 0.29
26 0.3
27 0.34
28 0.33
29 0.32
30 0.34
31 0.31
32 0.34
33 0.32
34 0.27
35 0.19
36 0.17
37 0.16
38 0.12
39 0.11
40 0.08
41 0.07
42 0.06
43 0.06
44 0.05
45 0.07
46 0.12
47 0.13
48 0.16
49 0.19
50 0.26
51 0.34
52 0.41
53 0.46
54 0.5
55 0.57
56 0.66
57 0.72
58 0.75
59 0.77
60 0.8
61 0.83
62 0.78
63 0.78
64 0.72
65 0.67
66 0.59
67 0.58
68 0.57
69 0.55
70 0.57
71 0.52
72 0.48
73 0.44
74 0.41
75 0.33
76 0.24
77 0.17
78 0.12
79 0.11
80 0.11
81 0.13
82 0.19
83 0.27
84 0.35
85 0.41
86 0.43
87 0.43
88 0.52
89 0.54
90 0.53
91 0.54
92 0.54
93 0.56
94 0.54
95 0.51
96 0.43
97 0.41
98 0.36
99 0.33
100 0.28
101 0.27
102 0.31
103 0.4
104 0.44
105 0.46
106 0.49
107 0.44
108 0.46
109 0.41
110 0.4
111 0.36
112 0.34
113 0.3
114 0.28
115 0.27
116 0.24
117 0.21
118 0.19
119 0.15
120 0.16
121 0.17
122 0.17
123 0.17
124 0.19
125 0.19
126 0.17
127 0.17
128 0.14
129 0.14
130 0.15
131 0.15
132 0.13
133 0.12
134 0.12
135 0.12
136 0.11
137 0.11
138 0.11
139 0.11
140 0.13
141 0.13
142 0.15
143 0.15
144 0.15
145 0.18
146 0.19
147 0.2
148 0.24
149 0.25
150 0.25
151 0.24
152 0.24
153 0.2
154 0.17
155 0.16
156 0.12
157 0.1
158 0.09
159 0.09
160 0.08
161 0.08
162 0.08
163 0.07
164 0.06
165 0.05
166 0.07
167 0.07
168 0.07
169 0.08
170 0.08
171 0.08
172 0.1
173 0.1
174 0.1
175 0.11
176 0.11
177 0.11
178 0.11
179 0.11
180 0.08
181 0.08
182 0.08
183 0.08
184 0.09
185 0.1
186 0.11
187 0.13
188 0.13
189 0.13
190 0.14
191 0.16
192 0.22
193 0.21
194 0.2
195 0.21
196 0.21
197 0.21
198 0.19
199 0.16
200 0.09
201 0.11
202 0.14
203 0.15
204 0.19
205 0.2
206 0.21
207 0.22
208 0.24
209 0.27
210 0.27
211 0.24
212 0.27
213 0.36
214 0.37
215 0.39
216 0.45
217 0.49
218 0.5
219 0.54
220 0.56
221 0.58
222 0.66
223 0.7
224 0.72
225 0.75
226 0.78
227 0.83
228 0.82
229 0.79
230 0.79
231 0.75
232 0.71
233 0.67
234 0.65
235 0.58
236 0.53
237 0.52
238 0.5
239 0.47
240 0.43
241 0.37
242 0.37
243 0.42
244 0.4
245 0.35
246 0.29
247 0.31
248 0.3
249 0.3
250 0.25
251 0.23
252 0.2
253 0.22
254 0.2
255 0.17
256 0.17
257 0.16
258 0.16
259 0.14
260 0.13
261 0.11
262 0.12
263 0.13
264 0.13
265 0.13
266 0.12
267 0.1
268 0.12
269 0.12
270 0.11
271 0.13
272 0.12
273 0.11
274 0.13
275 0.13
276 0.15
277 0.16
278 0.19
279 0.16
280 0.19
281 0.19
282 0.18
283 0.17
284 0.15
285 0.14
286 0.12
287 0.11
288 0.08
289 0.08
290 0.09
291 0.09
292 0.08
293 0.07
294 0.07
295 0.08
296 0.09
297 0.09
298 0.09